tall girl




FC2NATREBODBLKJUFEKSBJAUKGDTTJULHODVPPPDAMBIVEMACAWDGMEMSSISSHKDDASDWAAAHDKAMEYD

2020-07-23
127 min

[BNST-012]She's Got A Lustfully Wet Body With Giant Balloon Titties She's Having Breaking In Sugar Daddy-Hunting Raw Fucking Sex With A Dirty Old Middle-Aged Man A Tall College Girl Himari (23 Years Old) Himari Kinoshita

  • himari kinoshita censoredbeautiful girlsingle workBNSTteacher mousouzokukamagramBNST-012BNST012bnst00012
    • 2020-07-20
    117 min

    [BLOR-149]A Voluptuous Young Lady Who Works At A Beef Bowl Chain Restaurant This Tall Girl Has A Dry Wit But When You Pump Her Pussy With A Big Cock, She Starts Melting Like A Horny Cunt, Deep Down That Glory Hole, And Will Cum Like Crazy!

  • censoredbig titshandjobBLORbroccoli delusion groupbroccoliBLOR-149BLOR149blor00149
    • 2020-07-19
    49 min

    230ORETD-706 Sari-chan

  • amateur censoredamateurbeautiful girloretdoretd-706oretd706230oretd-706
    • 2020-07-19
    53 min

    230ORETD-707 Himari-chan

  • amateur censoredcreampiebig titsoretdoretd-707oretd707230oretd-707
    • 2020-07-17
    58 min

    FC2PPV 1439358 Tall beauty 172 cm tall preeminent style JD Miyabi 21 years old Lustful beautiful legs small breasts girl Sensitive BODY trembles in agony Obedient rich blowjob Repeatable crazy cum shot sex Personal Shooting With benefits – Part

  • amateur uncensoredfc2
    • 2020-07-16
    140 min

    [SSNI-838]Mixed Body Fluids, Deep Sex Completely Uncut Special Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSNIs1 no 1 stylemon cSSNI-838SSNI838ssni00838
    • 2020-07-10
    90 min

    [hoi-117]日葵(23)

  • amateur censoredamateurbeautiful girlhoihoi-117hoi117hoi-117
    • 2020-07-07
    106 min

    [418YSS-34]みなみ

  • amateur censoredbig titsamateuryssyss-34yss34418yss-34
    • 2020-07-07
    120 min

    [418YSS-35]あや

  • amateur censoredbig titsamateuryssyss-35yss35418yss-35
    • 2020-07-06
    48 min

    [188HINT-0409]なつみ

  • amateur censoredcreampiebig titshinthint-0409hint0409188hint-0409
    • 2020-07-03
    87 min

    428SUKE-028 No Hand Squirting Tuna-chan! Occupational Spear Man Model. Enchanted Soft Ass, Constriction, Beautiful Legs! Skeleotard Bite In And Overflowing With Man Meat W Nice Thighs Sandwiched Between Face Cowgirl! Second Round Sex With Nuruteka Oi

  • amateur censoredcreampiesquirtingsukesuke-028suke028428suke-028
    • 2020-07-02
    88 min

    435MFC-020 HONOKA

  • amateur censoredcreampiebig titsmfcmfc-020mfc020435mfc-020
    • 2020-06-28
    71 min

    428SUKE-027 In-car masturbation girl who eats thrills, outdoor girl Luna appeared. She has slender legs on a tight neck. A nasty beauty who can’t stand in the car or in the bathroom! Blow while being ona with toys! High-speed piston in the air f

  • amateur censoredcreampiesquirtingsukesuke-027suke027428suke-027
    • 2020-06-27
    139 min

    [KNMB-002]Kannama STYLE @Himari #TallGirlNiceLegs #SRankWoman #ShyGirl #HalfInHalfOut #SensitivePussy #LongHair - Himari Hanazawa

  • himari hanazawa censoredcreampieKNMBfirst starcomplete raw styleKNMB-002KNMB002h-491knmb00002
    • 2020-06-27
    180 min

    [JUFE-187]This Attractive Married Woman With Long And Slender Legs And A Tall Hot Body Is A Natural Airhead With Big Tits And A Beautiful Smile, And She's Making Her Adult Video Debut Behind Her Husband's Back! Misa Kuroki

  • misa kuroki censoredbig titsmarried womanJUFEfitchJUFE-187JUFE187jufe00187
    • 2020-06-25
    80 min

    200GANA-2298 Seriously Nampa, First Shot. 1495 Insurance Saleswoman Is Stressed And Horny! Break Stockings And Start Divergent Sex! !! The Slender Body, Which Is Sensitive To Repeated Close Contact, Shakes And Repeats The Climax!

  • amateur censoredamateurganagana-2298gana2298200gana-2298
    • 2020-06-25
    114 min

    [FSDSS-053]Fresh Face, 152cm Tall So Small / Round G Cup So Big / Masho Arisaka AVDEBUT

  • arisaka mayoi censoredbig titsbeautiful girlFSDSSfalenofaleno starFSDSS-053FSDSS0531fsdss00053
    • 2020-06-25
    121 min

    [FSDSS-055]Just How Good Are An S-Rank Actress's Handjob, Blowjob, And Pussy？ - Arina Hashimoto's Sex Measurements

  • there is hashimoto censoredbeautiful girlsingle workFSDSSfalenofaleno starFSDSS-055FSDSS0551fsdss00055
    • 2020-06-12
    48 min

    345SIMM-443 [Naked Esthetics] Continuous Creampie SEX To Enjoy The Outstanding Style Of Model-Class Tall Beauty Estheticians

  • amateur censoredcreampieamateursimmsimm-443simm443345simm-443
    • 2020-05-31
    76 min

    451HHH-001 A Real Record 200 A Woman Who Slashed And Has A Spectacular Past Who Made Her Husband Just Before Marriage! Complete document without spoiling! !! Exposing everything, shaking the finest body of Kamijiri & Explosive G milk and spree wit

  • amateur censoredbig titsamateurhhhhhh-001hhh001451hhh-001
    • 2020-05-29
    61 min

    300NTK-370 170cm F Cup Beauty Secretary Slimming Busty Exquisite Style! !! Love That Turns Into An Old Man’s Stalker! !! The Ultimate Goal Is The Bride Of Ojisan! !! Ascending To The Middle Alive Continuously With A Apt Raw Piston In Flying Brid

  • amateur censoredcreampiesquirtingntkntk-370ntk370300ntk-370
    • 2020-05-28
    78 min

    [hoi-104]枚方さん(32)

  • amateur censoredbig titsamateurhoihoi-104hoi104hoi-104
    • 2020-05-25
    61 min

    [299EWDX-305]カノンさん 32歳 元モデルの黒髪美人 【セレブ奥さま】

  • amateur censoredmarried womanamateurewdxewdx-305ewdx305299ewdx-305
    • 2020-05-23
    177 min

    [AKID-073]College Girl Babes Only After The Party, We Took Them Home For A Peeping Good Time And Then We Sold The Footage As An Adult Video Without Permission No.37 Creampie Sex With A Sexy Elder Sister Type Kumi/J-Cup Tits/21 Years Old (Creampie Sex

  • censoredcreampieAKIDtake outmanji groupAKID-073AKID073akid00073
    • 2020-05-23
    63 min

    300NTK-367 175cm9 Get A Super Beautiful Woman With A Head And Body In Sugamo! !! For Her Grandmother’S Indentured Servitude, She Has Sex In A Lotion Pool In A Swimsuit! !! Tall Beauty Naked Body Swells Dynamic Raw Sexual Intercourse And Finally

  • amateur censoredcreampieamateurntkntk-367ntk367300ntk-367
    • 2020-05-23
    120 min

    [NNPJ-388]178cm Tall! A Tall Girl With Model-Class Looks She's 19 Years Old But Looks Like A Cool Grownup (The Truth Is That She Feels Insecure About Her Height) And Now She's Shaking Her Beautiful Legs As She Cries Like A Baby While I'm

  • censoredsquirtingNNPJnampa japanNNPJ-388NNPJ388nnpj00388
    • 2020-05-21
    125 min

    [FSDSS-042]Arina In A Totally Nude Shocking Transfer The Interview Special Arina Hashimoto

  • there is hashimoto censoredbeautiful girlFSDSSfalenofaleno starFSDSS-042FSDSS0421fsdss00042
    • 2020-05-19
    48 min

    FC2PPV 1376126 ★ Appearance ☆ Dirty Little Ao-Chan, A Tall Beautiful Girl, Is Back! ☆ Slender Beauty Body Is Exquisite ♥ Immediately Iku Sensitive Pussy ♥ Soaked Pussy Pierced With Cancer ♥ [Personal Shooting] * With Benefits!

  • amateur uncensoredfc2
    • 2020-05-19
    193 min

    [KMHRS-020]A Tall Handsome Girl With Short Hair - Unable To Control Her Sexual Desire, She Makes Her Porno Debut - Raira Takizawa

  • lyra takizawa censoredamateursingle workKMHRSsod createtrendy yamaguchikimihoreKMHRS-020KMHRS0201kmhrs00020
    • 2020-05-19
    128 min

    [STARS-243]She Enjoyed Raw Creampie Sex For The First Time Ever After Cumming Out Of Abstention Maria Wakui

  • maria wakui censoredcreampiebeautiful girlSTARSsod createk westsod starSTARS-243STARS2431stars00243
    • 2020-05-16
    190 min

    [SSNI-791]Mixed Body Fluids, Deep Sex: Complete And Uncut 4 Sex Scenario Special: Izuna Maki

  • izuna maki censoredbeautiful girlSSNIs one number one stylecrests1 no 1 styleSSNI-791SSNI791ssni00791
    • 2020-05-15
    53 min

    300NTK-362 F Cup! !! 170cm Beauty Slender Slimming Busty Beauty Companion! !! De Nasty With A High Desire For Career Advancement And Libido! ？？ Milk Emphasized By The Gachi Costume At The Time Of The Race Queen! !! Butt! !! Constriction! !! It’S

  • amateur censoredcreampieamateurntkntk-362ntk362300ntk-362
    • 2020-05-15
    136 min

    [ZMEN-052]My Female Boss's Pantyhose Is Giving Me A Boner! I Couldn't Control Myself So I Rubbed Myself Against Her And She Was Dripping Wet... 5

  • misono waka kayo iwasawa censoredZMENz menkoenji goroZMEN-052ZMEN052h-1371zmen00052
    • 2020-05-15
    78 min

    430MMH-010 Big! white! Here is the body that squeezes semen w Honestly, my eyes go to my chest and it is not a stretch. Stretch to attack without missing fatigue! Iki hell with a horse riding blowjob and fingering! It’s too violent and on the ve

  • amateur censoredbig titsamateurmmhmmh-010mmh010430mmh-010
    • 2020-05-05
    53 min

    407KAG-062 [Sora Gachi Amateur Individual Shooting] Gonzo video of baby-faced x slender tall female college student Saffle is unapproved! !! Enjoy beautiful legs with footjob by wearing fishnet tights ☆ Continuous big cum ww while naive girls are puz

  • amateur censoredamateurkagkag-062kag062407kag-062
    • 2020-05-04
    71 min

    326SPB-001 A metamorphosis father’s treasured cosplay Gonzo video leaked ww 171 cm tall G cup beauty (35) is cramping in 4 kinds of swimsuits and swimsuits! !! Massive semen bombing www

  • amateur censoredcreampiebig titsspbspb-001spb001326spb-001
    • 2020-05-03
    120 min

    [ONIN-048]This Big Tittied Wife Gets Her Jiggle On At A Perverted Salon! See Her Cumming Hard In Steamy, Oily Massage Parlor Action.

  • censoredbig titsmarried womanONINonion delusion groupkarasuma peperoncinoonionONIN-048ONIN048onin00048
    • 2020-05-02
    102 min

    390JAC-044 [Tall Tennis Girls X Saddle Tide Creampie 3 Barrage] The United States Fell In Love … 2020 Erodemy Award Total Name! Leading Actress Award, God Style Award, Sensitive Climax Saddle Tide Award, Personality Favorability Award, No Good I

  • amateur censoredcreampiesquirtingjacjac-044jac044390jac-044
    • 2020-05-02
    120 min

    [NKKD-165]This Bad Girl Wife From The Neighborhood Persuaded Her To Put Her Name Into An Apartment Wife Prostitution Ring Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredbig titsmarried womanNKKDjet videogroupNKKD-165NKKD165nkkd00165
    • 2020-05-01
    68 min

    300NTK-354 170cm Slender Nice Bottom Beauty Ol! !! I Think It’S A Highly Conscious Tuna! !! Favorable Explosion Beauty Bitch Metamorphosis Discovery Panting By Licking Anal! ？？ Standing Back In A Tight And Tight Ass, A Fierce Piss Success Or Fai

  • amateur censoredcreampieamateurntkntk-354ntk354300ntk-354
    • 2020-04-26
    149 min

    [KTKZ-070]Sudden Arrival In Japan From The USA! Chloe, The Super Domineering College Girl From A Prestigious American Private University Wears Out A Whole Group Of Japanese Male Actors! Now This Is A REAL Pornstar!

  • censoredcreampieKTKZkitixx mousouzokuno directorshinjinKTKZ-070KTKZ070ktkz00070
    • 2020-04-25
    150 min

    [MIFD-112]Working For The Knee High Socks Project Planning And Development Department Of A Famous Apparel Company! This Newly Graduated, Tall Girl Landed A Provisional Offer By Showing Off Her Total Domain, And Now Makes Her AV Debut Haruka

  • haruka censoredbeautiful girlsingle workMIFDmoodyzmon cmoodyz freshMIFD-112MIFD112mifd00112
    • 2020-04-25
    69 min

    300NTK-351 J Cup! !! Glamorous Style Beauty! !! The Sexual Desire Is Also Glamorous (Personal Talk) The Omnidirectional Milk-Enclosed Fucking Of The Bottle Bowl Esthetician Who Devours The Host Of Kabukicho! !! The Semen Raw Squeezing Is A Must! !! /

  • amateur censoredcreampiebig titsntkntk-351ntk351300ntk-351
    • 2020-04-19
    162 min

    [AKID-072]College Girl Babes Only After The Party, We Took Them Home For A Peeping Good Time, And Then We Sold The Footage As An Adult Video Without Permision No.36 Creampie Sex With A Beautiful College Girl Magazine Reader Model Miho/E-Cup Tits/21 Y

  • censoredcreampieAKIDtake outno directormanji groupAKID-072AKID072akid00072
    • 2020-04-18
    89 min

    [401SRHO-020]なつ(22)

  • amateur censoredamateurbeautiful girlsrhosrho-020srho020401srho-020
    • 2020-04-17
    69 min

    300NTK-346 No.1 Beautiful Ass Advent! !! Surprise Joy And Stick Out Nice Ass And Squirting Pleasure With Back Fingering! !! As I Say Many Times … Icharab Raw Sex Of A Tall Model-Class Style Apt Beautiful Girl! !! There Is No Reason Not To Come O

  • amateur censoredcreampieamateurntkntk-346ntk346300ntk-346
    • 2020-04-16
    50 min

    [398CON-055]リン(25)

  • amateur censoredcreampiemarried womanconcon-055con055398con-055
    • 2020-04-15
    61 min

    FC2PPV 1336738 ★ Appearance ☆ Height 170 Cm Big Ass Plump Body Active Jd Eru-Chan 20 Years Old ☆ Iki Rolled Up With Electric Massage To A Tall Big Girl ♥ Thick Blowjob Entwined With Sticky ♥ Raw Squirrel Cum Shot Insemination ♥ [Personal Shooting ] *

  • amateur uncensoredfc2
    • 2020-04-15
    77 min

    435MFC-001 Emachi

  • amateur censoredamateurbeautiful girlmfcmfc-001mfc001435mfc-001
    • 2020-04-12
    84 min

    420HOI-034 Kaho-chan

  • amateur censoredbig titsamateurhoihoi-034hoi034420hoi-034
    • 2020-04-10
    87 min

    FC2PPV 1331119 Complete Appearance ♥ ️ Tall Over 170 Cm & Fair-Skinned Slender Body With 8 Heads ♥ ️ A Shy Beautiful Girl Is Vaginal Cum Shot With Raw Etch In A Girl ○ Raw Uniform ♥ ️ Massive Vaginal Cum Shot Without Permission To Pink Pussy ♥ ️ ♥

  • amateur uncensoredfc2
    • 2020-04-05
    86 min

    420HOI-033 konowa

  • amateur censoredamateurbeautiful girlhoihoi-033hoi033420hoi-033
    • 2020-04-04
    142 min

    [SSNI-754]Mixed Body Fluids, Deep Sex Complete And Uncut Special Lena Kodama

  • kodama rena censoredbeautiful girlsingle workSSNIs1 no 1 stylemon cSSNI-754SSNI754ssni00754
    • 2020-04-04
    170 min

    [432YKMC-01]まなみ さくら

  • amateur censoredbig titsmarried womanykmcykmc-01ykmc01432ykmc-01
    • 2020-03-31
    67 min

    300NTK-337 G Cup Tall Model Class Beauty! !! Excited about H after a long absence! !! A beautiful man who is caressed with clothes and gets wet is immediately tide-blowing Binkan liking! !! "Because it’s been a long time … ♪", happi

  • amateur censoredcreampiebig titsntkntk-337ntk337300ntk-337
    • 2020-03-27
    83 min

    300NTK-334 Tall x G Cup x Beautiful Girl And Nasty! !! Reverse Nan addict with a model-class slender body! ？？ Call out to the erotic JD duo and defeat each one! !! Senior JD beauty fell into a good-looking guy without permission, so it was delicious

  • amateur censoredcreampieamateurntkntk-334ntk334300ntk-334
    • 2020-03-22
    150 min

    [FLAV-238]HYPER FETISH - Sexy Queens In High Leg Costumes - Kanon Nakajou

  • nakajo canon censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-238FLAV238flav00238
    • 2020-03-21
    163 min

    [AKID-071]College Girls Only - Peeping On Girls Who've Been Out Partying, And Turning It Into A Porno 35 - College Girls Beg For Creampies Edition - Mako, 21yo (Has A Boyfriend, Wants Revenge On Him For Cheating) - Ayaka, 21yo (Picked Up At The B

  • censoredcreampiebeautiful girlAKIDtake outmanji groupAKID-071AKID071akid00071
    • 2020-03-11
    53 min

    [230OREC-483]みれい

  • amateur censoreduniformamateurorecorec-483orec483230orec-483
    • 2020-03-10
    76 min

    200GANA-2231 Seriously Nampa, first shot. 1459 I landed in Ebisu in the middle of winter! Picking up a super-dreadnought Ibekon beauty with both face and body! While saying "Naughty things are not good", Paipanma ● Ko is desperately getting w

  • amateur censoredbig titsamateurganagana-2231gana2231200gana-2231



    • Jav Movie Free Download