creampie




FC2ROYDONEZIPXHDKADASDVEMACESDDTTPREDADNPPPDWAAAMIAASSISSDABRBDSHKDNATRBLKMEYD

2023-09-29
120 min

WAAA-303 I Asked My Plump Wife At My Part-time Job To Be My Tutor... Ai Sayama

  • sayama love censoredcreampiesingle workWAAAones factorywanzWAAA-303WAAA303waaa00303
    • 2023-09-29
    120 min

    MIAA-978 Pheromone Brother"s Wife Is Turned Into A Reverse Bunny Housekeeper, And A Runaway Dick Turns Into A Meat Urinal And Immediately Cums In Her Pussy 14 Times Kaho Tamaki

  • tamaki natsuho censoredcreampiecosplayMIAAmoody scaptain gangwoneveryone s kikatanMIAA-978MIAA978miaa00978
    • 2023-09-29
    105 min

    VEC-615 Creampie Courtship Sex With A Fascinating Single Mother Who Moved Next Door To My Apartment Yuuki Hiiragi

  • hiiragi yuuki censoredcreampiesingle workVECvenuskanyegoddess venusVEC-615VEC615vec00615
    • 2023-09-29
    260 min

    DVMM-021 Special Shooting ≪100 Human Breasts Massaged And Picked Up≫ Returns! Vol.02 Once Again, “Let’s Energize Japan With The Power Of Breasts!” ! ” Call The Big-breasted Girl → Immediately Rub It Again → → This Time Until SEX! ! Massage The Raw Br

  • censoredcreampieamateurDVMMdeepsfunky haseideep sDVMM-021DVMM021dvmm00021
    • 2023-09-29
    210 min

    WAAA-300 If You Can Endure Rima Arai"s Amazing Technique, You Can Have Raw ★ Creampie Sex!

  • lima arai censoredcreampiebeautiful girlWAAAones factorywanzWAAA-300WAAA300waaa00300
    • 2023-09-29
    56 min

    fc2-ppv 3760366 [Personal Shooting] Marin, 22 Years Old, Treasured, Sober, Dirty, Secretive Woman, Massive Creampie For College Student FC2-PPV-3760366

  • amateur uncensoredcreampieamateur
    • 2023-09-29
    70 min

    fc2-ppv 3873421 ★ Face Showing ★ Amateur Came To Do Naughty Things! Case #11 Miyu-chan (20), Who Has 100 Beautiful G-cup Breasts In One Year [Bonus Included] FC2-PPV-3873421

  • amateur uncensoredcreampie
    • 2023-09-29
    120 min

    CAWD-586 A 13 Year Old Figure Skater With No Experience In Sex Orgy, A Genius Girl Is Tortured With 19 Big Cocks And Creampied For The First Time Shion Chibana

  • chibana shion censoredcreampiebeautiful girlCAWDkawaiimichiru arashiyamaCAWD-586CAWD586cawd00586
    • 2023-09-29
    240 min

    DVMM-020 Face Showing MM Issue Beautiful Wives Only The Magic Mirror Best Friends Competing Against Each Other! Virgin Reverse Pick-up Ejaculation Battle! ! 2 A Married Woman Gives A Handjob, Onajob, And Blowjob To A Younger Virgin She Just Met While

  • censoredcreampieamateurDVMMdeepscapthe magic mirror mm mm flightsDVMM-020DVMM020dvmm00020
    • 2023-09-29
    82 min

    534CRT-012 Extremely Rare [24 Hour Wear] Ha●Professional Research Student_Red T"s Competitive Underwear

  • amateur censoredcreampieamateurcrtcrt-012crt012534crt-012
    • 2023-09-29
    69 min

    fc2-ppv 3871827 [Uncensored X Personal Shooting] A Beautiful Wife From A Certain Beauty Pageant! A Beautiful Witch Who Doesn"t Look Like She"s 42 Years Old Transforms Into An Erotic Wife From A Memory Shoot Where She Says, ``I Want To Record

  • amateur uncensoredcreampiemarried woman
    • 2023-09-29
    262 min

    FLVA-038 A Beautiful Girl Who Is Made To Lick The Pussy Juice. A Masturbation-addicted Tsuruman J-type Girl Who Makes You Suck The Smell And Taste Of Sticky Pussy Love Juice And Has Tongue-inserted Masturbation Sex, Dripping With Joy And Orgasms. Nan

  • kisaki nana censoredcreampieschoolgirlFLVAdeepsmotofuji peroflavors flavorsFLVA-038FLVA038flva00038
    • 2023-09-29
    65 min

    476MLA-154 [NTR Egg Creampie] Please Impregnate My Fiance"s Girlfriend With Sperm Other Than Mine...! A Tragically Beautiful Woman Who Is Forced To Follow The Sexual Tendencies Of Her Seriously Ill Boyfriend Who Has Awakened To A Desire To Have E

  • amateur censoredcreampiemarried womanmlamla-154mla154476mla-154
    • 2023-09-29
    58 min

    299EWDX-465 Picking Up Celebrity Married Women With Outstanding Sensitivity! Screaming Climax!

  • amateur censoredcreampiemarried womanewdxewdx-465ewdx465299ewdx-465
    • 2023-09-29
    160 min

    MIAA-966 Ultra-luxury Creampie Specialty Soap Sora Amakawa

  • tenkawa sora censoredcreampielingerieMIAAmoody szach araieveryone s kikatanMIAA-966MIAA966miaa00966
    • 2023-09-29
    130 min

    FOCS-154 I Turned My Boss"s Plain-looking Daughter Into A Meat Urinal And Addicted To Dick With An Aphrodisiac Sex... Madoka Kuga

  • kuga madoka censoredcreampiebeautiful girlFOCSabc delusion groupfocusFOCS-154FOCS154focs00154
    • 2023-09-29
    120 min

    CAWD-588 Pure White G Cup, Aiho Suzu Kawaii* Exclusive Decision! Breasts Shaking Violently And Creampie Release Special

  • aiho tin censoredcreampiebeautiful girlCAWDkawaiisugawaraCAWD-588CAWD588cawd00588
    • 2023-09-29
    160 min

    BF-694 I Moved To The Countryside Due To A Job Transfer, And My Wife Who Lived Downstairs Seduced Me Every Day And I Ended Up Creampieing Her Many Times... Mizuki Yayoi

  • mizuki yayoi censoredcreampieslutBFbefreeroqueongBF-694BF694bf00694
    • 2023-09-29
    150 min

    JUFE-514 A Sexy Adult Woman Licks My Ear And Whispers Vulgar Dirty Words With Her Sweet Breath Kanna Misaki

  • kanna misaki censoredcreampieslutJUFEfitchyumeno aidaJUFE-514JUFE514jufe00514
    • 2023-09-29
    240 min

    BMW-291 "I Don"t Want It! I"m Definitely Not Allowed To Cum Inside!" 50 Consecutive Creampies Vol. 2

  • julia sayama love censoredcreampiebeautiful girlBMWones factorywanzBMW-291BMW291bmw00291
    • 2023-09-29
    248 min

    DVMM-024 Ordinary Male And Female Monitoring AV Two Beautiful Legged Cabin Attendants And Best Friends Try Their First 5-point Erotic Attack! While Being Tongue-tied, Both Nipples Are Teased And The Testicles Are Rubbed To Stop The Pre-cum From Dripp

  • censoredcreampieamateurDVMMdeepsfunky haseideep sDVMM-024DVMM024dvmm00024
    • 2023-09-29
    55 min

    299EWDX-462 Picking Up A Celebrity Married Woman G Cup Big Butt

  • amateur censoredcreampiebig titsewdxewdx-462ewdx462299ewdx-462
    • 2023-09-29
    120 min

    MIAA-958 A Caring G-cup Tits Private Tutor Who Thoroughly Manages Grades. Private Tutoring With Raw Creampie To Improve Grades. Yuri Morishita

  • morishita yuri censoredcreampieslutMIAAmoody scaptain gangwoneveryone s kikatanMIAA-958MIAA958miaa00958
    • 2023-09-29
    57 min

    fc2-ppv 3871017 *Limited Quantity For The First Time* [Married Woman/Individual Shooting] Adultery Sex Trip With Masturbation *** "Misaki" 29 Years Old FC2-PPV-3871017

  • amateur uncensoredcreampiemarried woman
    • 2023-09-29
    138 min

    DVRT-026 "I Dedicate My Daughter..." Impregnation Training, Insemination SEX In Front Of Her Parents Ena Koume

  • ena koume censoredcreampieschoolgirlDVRTdeepstokyo boydeep s 2nd storeDVRT-026DVRT026dvrt00026
    • 2023-09-29
    117 min

    328FANH-178 Maina-chan From The Swimming Club Who Is Weak Against Pressure, Sex With A Raw-loving Slut Who Can"t Refuse, Irresponsible Insemination Creampie With A Truly Lewd Girl

  • amateur censoredcreampieamateurfanhfanh-178fanh178328fanh-178
    • 2023-09-29
    115 min

    JJDD-009 An Old Housekeeper Who Can"t Say No To Creampie Sex When Asked By A Younger Boy 09 A Documentary Where She Takes Advantage Of His Kindness And Fucks Him Raw

  • censoredcreampieJJDDmature japanJJDD-009JJDD009jjdd00009
    • 2023-09-29
    64 min

    299EWDX-461 Picking Up Celebrity Married Women. Pleasure Outweighs Embarrassment...

  • amateur censoredcreampiebig titsewdxewdx-461ewdx461299ewdx-461
    • 2023-09-29
    117 min

    ORECS-051 Innocent Female College Students Mao And Kokomi Blush And Get Excited After Their First Kiss Under The Blue Sky

  • censoredcreampiebeautiful girlORECSmy amateur z second impactORECS-051ORECS051h-1732orecs00051
    • 2023-09-29
    214 min

    354VOV-114 A Gathering Of The Strongest Bitches! Bead Chain Orgy SEX Party Vol.49 "Could You Please Introduce Me To A Naughty Friend From Your Sister？"

  • amateur censoredcreampiebig titsvovvov-114vov114354vov-114
    • 2023-09-29
    110 min

    VEC-614 A Married Woman Who Was Creampied By Her Husband"s Friend Plays With Unfaithfulness To Fill The Gap In Her Lonely Body. Aime Mizuki

  • mizuki ai censoredcreampiesingle workVECvenussarugoddess venusVEC-614VEC614vec00614
    • 2023-09-29
    58 min

    299EWDX-464 Picking Up Celebrity Married Women Erotic Nipples Big Ass

  • amateur censoredcreampiebig titsewdxewdx-464ewdx464299ewdx-464
    • 2023-09-29
    120 min

    YUJ-010 "I"m Getting Married, Right？" That"s Right...Then I Won"t Let You Sleep Tonight...The Night Before My Wedding, I Creampied With My Ex-girlfriend For The First Time In 12 Years Until The Sun Rose. Tsubaki Sannomiya

  • sannomiya tsubaki censoredcreampieslutYUJattackersthere is alsokidding girlYUJ-010YUJ010yuj00010
    • 2023-09-29
    120 min

    ATID-574 "Old Man, I"m Home." Emma, ​​who Took Her Virginity, Has Returned For The First Time In 10 Years. Futaba Emma

  • futaba emma censoredcreampieschoolgirlATIDattackersdragon nishikawain madATID-574ATID574atid00574
    • 2023-09-29
    58 min

    092923-001 Mayu Omigawa Wants To Be Trained By A Beautiful Teacher In The Health Room

  • mayu komikawa uncensoredcreampie
    • 2023-09-29
    120 min

    SAME-075 If You Want A Recommendation, Suck My Dick. Sexual Harassment, Power Harassment, Etc. A Student Who Fell Into The Sexual Processing Tool Of A Selfish Teacher. Minami Maeda

  • maeda minami censoredcreampieschoolgirlSAMEattackerskitorune kawaguchideath night evilSAME-075SAME075same00075
    • 2023-09-29
    113 min

    328FANH-179 Yuzuki, A 23-year-old Medical Student With An Extremely High Erotic Deviation Score. If Found Out, She Will Be Expelled From School And Will Be Strictly Prohibited From Leaking. Showing Her Student ID Will Be Filmed Raw. She Will Go Crazy

  • amateur censoredcreampieamateurfanhfanh-179fanh179328fanh-179
    • 2023-09-29
    125 min

    JJDD-010 An Old Housekeeper Who Can"t Say No To Creampie Sex When Asked By A Younger Boy 10 Documentary Where She Takes Advantage Of His Kindness And Fucks Him Raw

  • censoredcreampieJJDDmature japanJJDD-010JJDD010jjdd00010
    • 2023-09-29
    120 min

    CAWD-595 Ichika, My Childhood Friend From Next Door Who Came To Borrow A Bath Because The Water Heater Was Broken, Couldn"t Stand The Sweaty Skin, The Smell Of Shampoo, And The Glimpse Of Her Small Breasts, So She Stole Away From Her Parents And

  • ichika matsumoto censoredcreampiesingle workCAWDkawaiitake dCAWD-595CAWD595cawd00595
    • 2023-09-29
    56 min

    fc2-ppv 3859845 Last Work! ! 1980pt Limited Until 10/6! She Is Modest, Graceful And Elegant, And Still Remains A Pure And Pure Beauty...her Past Thoughts Are Intertwined With Each Other, And Her Final Vaginal Ejaculation. FC2-PPV-3859845

  • amateur uncensoredcreampieamateur
    • 2023-09-29
    180 min

    JUFE-519 Big-assed Female Teacher Straddles A Man And Devours The Essence With Continuous Ejaculation SEX Mina Kitano

  • mina kitano censoredcreampiesingle workJUFEfitchxxlpreciousJUFE-519JUFE519jufe00519
    • 2023-09-29
    150 min

    JUFE-517 Old Man"s Gonzo Documentary - Sweaty Sexual Intercourse With Rich And Sticky Body Fluids - Mai Arisu

  • arisu mai censoredcreampieschoolgirlJUFEfitchlamb chopJUFE-517JUFE517jufe00517
    • 2023-09-29
    130 min

    CAWD-566 Sleep Rape Creampie Rape: Female Student Trained To Climax While Sleeping Natsu Hinata

  • natsu hinata censoredcreampieschoolgirlCAWDkawaiiasagiriCAWD-566CAWD566cawd00566
    • 2023-09-29
    120 min

    MIAA-979 As A Result Of Feminist Women Complaining That The Small Surface Area Of  

  • hinako mori censoredcreampiecosplayMIAAmoody sdragon nishikawaeveryone s kikatanMIAA-979MIAA979miaa00979
    • 2023-09-29
    154 min

    DVEH-015 Yuina Taki, A Tall And Beautiful Personal Trainer With A Voluptuous Big Butt Who Repeats The Temptation To Collapse Her Rationality In Search Of The Best Protein (sperm)

  • taki yuina censoredcreampiesingle workDVEHdeepspearl father jrdeep s 3rd storeDVEH-015DVEH015dveh00015
    • 2023-09-29
    69 min

    fc2-ppv 3872174 *Limited Time Only* [Endless Love!!] A Truly Beautiful Civil Servant Older Sister, 26 Years Old. The Older Sister Has A Strong Sexual Desire That Cannot Be Satisfied Even If She Cums Or Cums. She Is Masturbating With A Toy, Hyperventi

  • amateur uncensoredcreampieamateur
    • 2023-09-29
    147 min

    CAWD-570 When I Undressed A Plain And Inconspicuous Subordinate (female)...she Had The Most Amazing Body, And Ever Since That Day, We"ve Been Taking The Day Off From Work And Having Sex With Her All The Time. Yuhi Shitara

  • shitara yuhi censoredcreampiesingle workCAWDkawaiigoemonCAWD-570CAWD570cawd00570
    • 2023-09-29
    84 min

    KAMEF-051 S-class Receptionist Photo Session Specializing In Individual Photography Sally (27) Machida Lens"s BLACK KAMEKO FILE.51 The Private Life Of A Beautiful Receptionist From A Listed Company A Sex Video That Exposes All Of Her Proud Best S

  • censoredcreampieamateurKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-051KAMEF051h-1350kamef00051
    • 2023-09-29
    120 min

    WAAA-309 "Eh! You Just Let It Out Inside Me, Right？" After The Sudden Ejaculation, The Extension Piston Is Used To Catch Up And Cum Inside Without Pulling It Out! ! Mai Arisu

  • arisu mai censoredcreampieschoolgirlWAAAones factorywanzWAAA-309WAAA309waaa00309
    • 2023-09-29
    140 min

    WAAA-304 Iron Hook Tearing Pussies And Incontinence Torture BAR Manager Goes Crazy And Leaks Cum Inside A Prison Of Shame! ! AIKA

  • aika censoredcreampiesquirtingWAAAones factorywanzWAAA-304WAAA304waaa00304
    • 2023-09-29
    120 min

    CLUB-817 Chasing Her From The School Route To Her Home And Giving Her A Raw Creampie While She Was Asleep [Complete Voyeur] (Voyeur Panty Shots, Rape, Home Invasion, Close-up Shots Of Comatose Parts, Half-awake Night) (CLUB-817)

  • censoredcreampieschoolgirlCLUBhentai gentleman clubCLUB-817CLUB817club00817
    • 2023-09-29
    61 min

    299EWDX-463 Picking Up A Celebrity Married Woman. She Becomes Bold And Cries While Being Shy...

  • amateur censoredcreampiemarried womanewdxewdx-463ewdx463299ewdx-463
    • 2023-09-29
    120 min

    CAWD-582 "Huh, Do You Want Me To Lend You A Bath!？" I Suddenly Got An Erection At The Temptation Of My Cheerful Big-breasted Colleague"s Sexy Wet Hair And Defenseless Breasts Spilling Out Of Her Camisole... Mayuki Ito

  • maiyuki ito censoredcreampieslutCAWDkawaiisugawaraCAWD-582CAWD582cawd00582
    • 2023-09-29
    150 min

    WAAA-302 I Missed The Last Train After Drinking At Work And Stayed The Night At My Female Boss"s House, But It Was Discovered That I Ejaculated Prematurely, And I Was Made To Ejaculate Hard From Friday Night Until Monday Morning.Kana Morisawa

  • kana morisawa kanako iioka censoredcreampieslutWAAAones factorywanzWAAA-302WAAA302waaa00302
    • 2023-09-29
    120 min

    CAWD-577 Tall! Slender Waist And Narrow Waist! Beautiful Legs! A Slender Secretary"s Divine Service Harem Sakura Kurumi, Amiri Saito, And Nana Hoshimiya Are Praised For Their Erotic And Cute Revealing Costumes.

  • walnut sakura amiri saito censoredcreampiecosplayCAWDkawaiiinabarCAWD-577CAWD577cawd00577
    • 2023-09-29
    69 min

    fc2-ppv 3872037 Nana (18) 2nd Time It Was My Period, So I Took Pictures Of The Inside Of My Vagina During Menstruation, And I Cum In My Anus For The First Time, But In The End I Also Cum In My Vagina. FC2-PPV-3872037

  • amateur uncensoredanal
    • 2023-09-29
    180 min

    DVMM-023 Ordinary Male And Female Monitoring AV Amateur Sleepover Project Between Friends A Thorough Investigation To See If Two Young People Can Use Up One Box Of Condoms If They Spend 24 Hours Under The Same Roof! Will College Students And Men At T

  • censoredcreampieamateurDVMMdeepspoolsidedeep sDVMM-023DVMM023dvmm00023
    • 2023-09-29
    150 min

    MIAA-922 I Encountered A Former Young Senior Who Was Bullying Me At A Delivery Health Service For A Masochist Woman...The Positions Were Reversed And I Was Forced To Restrain Her And Force Her To Pee! Yuuki Hiiragi Was Made Into A Creampie Meat Urina

  • hiiragi yuuki censoredsquirtingsingle workMIAAmoody scomet akaieveryone s kikatanMIAA-922MIAA922miaa00922
    • 2023-09-29
    80 min

    fc2-ppv 3872190 0307_005 Hinano-chan, 19 Years Old, A Slutty Fair-skinned H-cup Beautiful Big-breasted Young Lady Who Is Growing Into An Increasingly Selfish Body, Makes A JD Wear A Super Mini-skinny Sailor Costume That Suits Her, Impregnates Her, An

  • amateur uncensoredcreampieamateur
    • 2023-09-29
    120 min

    NNPJ-574 Get It With Matching App! ! We Met And Went To A Super Fast Hotel And Had Sex Right Away! The Beautiful Wife Was A Fast-acting, Convenient, Free-spirited Bitch. Married Woman: Kokona-san

  • censoredcreampieNNPJnpjNNPJ-574NNPJ574nnpj00574



    • Jav Movie Free Download