chikan




FC2SDABABWHMNPPPDGVHSHKDSPRDNATRGMEMSTARSFSDSSVENXRBDAVSAVENUHUNTBJULMIDEATIDMEYD

2012-06-16
119 min

[PPPD-192]Maid's Hot Exposed Breasts Momo Shirato

  • momo shirato censoredbig titssingle workPPPDoppaino directorPPPD-192PPPD192pppd00192
    • 2012-06-28
    117 min

    [ZUKO-006]Squirting Screaming Wild Cumming Orgy

  • mizusawa mao nagasawa maomi kohaku uta censoredcreampiesquirtingZUKOzukkon bakkonrakudaZUKO-006ZUKO006zuko00006
    • 2013-02-07
    162 min

    [MIGD-496]AV Revival! Shaved Pussy x Real Creampies Yurina Ayashiro

  • saijo yurina censoredcreampiebeautiful girlMIGDmoodyztake dmoodyz gatiMIGD-496MIGD496migd00496
    • 2013-05-24
    117 min

    [SABA-006]The Night of the Angel's Descent - Downtown Vogue Service Saya Tachibana 23 Years Old

  • censoredamateurSABAskyu shirotoatlas musashiSABA-006SABA006h-244saba00006
    • 2013-12-02
    49 min

    [k0933]Go Hunting!--- Natsuki Fujii

  • natsuki fujii uncensoredbukkaketokyo hot
    • 2014-03-21
    118 min

    [HNDS-019]Man Fishing Island! Fuck Us As Much As You Want We Love Getting Creampied! Special

  • otsuki sound haruki sato censoredcreampiesquirtingHNDShon nakatiger kosakaiHNDS-019HNDS019hnds00019
    • 2014-05-09
    118 min

    [XV-1205]1 in a 1000, the Miraculous Slut Tongue. Licking and Sperm Drinking Sex. Ria Kotone

  • kotone ria censoredsingle workXVmax ahada kanXV-1205XV120560xv01205
    • 2015-09-25
    120 min

    [MOM-019]Abnormal Sex - 50-Something MILF Services Her Husband And Son At The Same Time Sachiyo Hanaoka

  • sachiyo hanaoka censoredcreampiebig titsMOMi b worksmomo puriMOM-019MOM019143mom00019
    • 2015-10-01
    112 min

    [KIL-086]I Showed A Cleaning Lady Sent Over To My House My Bare Dick, And Though She Was Embarrassed, She Was Also Totally Excited...

  • censoredKILprestigeace killerKIL-086KIL086118kil00086
    • 2016-03-14
    48 min

    [k1290]Go Go Hunting!--- Sana Sawaguchi

  • sana sawaguchi uncensoredbukkaketokyo hot
    • 2016-03-26
    176 min

    [IPZ-727]Call Girl SEX - We Deliver Yuki Yoshizawa Right To Your Doorstep

  • yuki yoshizawa censoredbig titsamateurIPZidea pocketxavier thomasdishIPZ-727IPZ727ipz00727
    • 2016-03-27
    87 min

    [VENU-592]Bath House Incest - Mother and Son Fuck In the Bath Yuna Takase

  • yuna takase censoredcreampiemature womanVENUvenuspe taVENU-592VENU592venu00592
    • 2016-09-01
    118 min

    [AVOP-208]My Cute Little Niece While Living Together As Brother/Sister, My Shotacon Big Sister Crossed The Lines Of Family Love Kana Yume

  • kana yui censoredsingle workAVOPmaxingdera 3AVOP-208AVOP208h-068avop00208
    • 2017-01-13
    85 min

    [HQIS-020]A Henry Tsukamoto Production The Wife's Secret Meeting I Hope My Husband Never Finds Out...

  • kazama yumi reiko sawamura honami takasaka masumi takasaka censoredmature womansingle workHQISfa proupdatingHQIS-020HQIS020hqis00020
    • 2017-01-20
    120 min

    [ELEG-010]WifeLife Vol.010 Reika Kisaragi , Born In Showa Year 37, Is Going Cum Crazy She Was 46 Years Old At The Time Of Filming Her Body Sizes From The Top To Bottom Are: 88/58/87 87

  • kisaragi reika censoredblowjobmature womanELEGsex agent daydreamersdont knoweleganteELEG-010ELEG010h-213eleg00010
    • 2017-02-23
    110 min

    [MUDR-015]Ever Since That Day... A Schoolgirl Is In S&M Creampie Breaking In Training Mayu Yuki

  • mayu yuuki censoredcreampieschoolgirlMUDRmukuMUDR-015MUDR015mudr00015
    • 2017-05-05
    63 min

    [050517_522]モデルコレクション 伊藤果夏

  • amateur uncensored1pondo
    • 2017-08-11
    120 min

    [UMSO-148]A Beautiful Korean Jogger vol. 1

  • censoredbig titsUMSOk m produceupdatingUMSO-148UMSO14884umso00148
    • 2018-03-08
    120 min

    [RCTD-082]Dirty Talk Female Anchor 14 She Wants To Be The Masturbation Doll Of Your Dreams While She Strokes You To Furious Ecstasy! A Masturbation Doll Special

  • kiriyama yuu yukari miyazawa censoredhandjobRCTDrocketkobe taroRCTD-082RCTD0821rctd00082
    • 2018-03-08
    201 min

    [IENE-872]It's Awesome To Lose Your Virginity To A Kind, Experienced Amateur Married Woman 13

  • censoredcreampiemarried womanIENEi energyie nergyIENE-872IENE8721iene00872
    • 2018-04-07
    208 min

    [JUY-450]A Married Woman With A Short Bob Hairstyle Miori Matsumura Her AV Debut!! This Fashionable Missus, Aged 33, Works In The Marunouchi District And Has Been Married For 7 Years

  • miori matsumura censoredbig titsmature womanJUYmadonnamametaro mamezawaJUY-450JUY450juy00450
    • 2018-06-07
    199 min

    [SVDVD-665]I'm A Fresh Face Nurse At The In Vitro Clinic And Now I've Been Placed In The Semen Extraction Room... 2

  • naoki kiritani jinguji temple nao censorednurseSVDVDsadistic villagetweet jiroSVDVD-665SVDVD6651svdvd00665
    • 2018-06-14
    159 min

    [BLK-368]All The Local Boys Did Her! A Selfish Cowgirl Fuck That's Way Out Of Control!! We're Seducing This Childhood Friend Slutty Elder Sister For Her AV Debut!!

  • censoredsquirtingBLKkira kiraupdatingBLK-368BLK368blk00368
    • 2018-07-11
    81 min

    [IMPVE-017]Come With Me, Lover Yuko Misaki

  • yuko misaki censoredIMPVEimpactIMPVE-017IMPVE017h-1154impve00017
    • 2018-09-06
    172 min

    [HAWA-152]Secretly Spending The Night With An Amateur Married Woman Behind Her Husband's Back

  • censoredmarried womanamateurHAWAcosmos videonagase hawaiicosmospictures soft on demandHAWA-152HAWA1521hawa00152
    • 2018-09-28
    480 min

    [FSB-006]Filthy Video Collection 06

  • censoredmature womanFSBprestigefullsail bestFSB-006FSB006118fsb00006
    • 2018-11-14
    70 min

    MGMR-107 Kotchin 2

  • amateur censoredschoolgirlamateurmgmrmgmr-107mgmr107mgmr-107
    • 2018-12-06
    122 min

    [NGOD-088]I Want To Tell You My Cuckold Story. A Young, Faithful Wife Gets Fucked Her Husband's Dirty, Middle-Aged Boss. Tsubasa Hachino

  • yano tsubasa censoredbig titssingle workNGODjet eizoNGOD-088NGOD088ngod00088
    • 2018-12-07
    480 min

    [FSB-017]Filthy Video Collection 17

  • censoredmature womanFSBprestigefullsail bestFSB-017FSB017118fsb00017
    • 2019-01-17
    240 min

    [HUNTA-543]Repeat Customers Welcome! You Can't Touch, But These Fresh-Faced Massage Parlor Girls Won't Say No When You Shove Your Raw Dick Inside Them Fro Behind! They'll Cum Until They Can't Even Stand Up! You Put In An Order For A H

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-543HUNTA543hunta00543
    • 2019-01-20
    52 min

    [274ETQT-318]巨乳妻Fカップ りか28歳

  • amateur censoredcreampiebig titsetqtetqt-318etqt318274etqt-318
    • 2019-01-25
    66 min

    FC2PPV 1023008 [Celebration] Passed the recommendation! Kanna-chan (18) A vine peta girl who grew up in a girls’ school and a circle 〇 Gonzo ♡ SEX A piston that thrusts an erotic girl who wants to get rid of it! Remove the healthy body trained i

  • amateur uncensoredfc2
    • 2019-04-04
    239 min

    [HUNTA-580]When You Tickle This Stepmom And Her Ultra Sensual Nipples, She'll Bend Over Backwards With Consecutive Violent Orgasms!! I Suddenly Got A Young And Pretty New Stepmom!! And Already It Seems She Stopped Having Sex With My Dad, And It&#

  • censoredcreampieHUNTAhuntervolvo nakanohhh groupHUNTA-580HUNTA580hunta00580
    • 2019-04-05
    121 min

    [KCDA-253]Super Mini Skirt High School Girls Cowgirl 20 Girls

  • censoredbig titsschoolgirlKCDAdigital arkdigital ark digital arkKCDA-253KCDA253kcda00253
    • 2019-07-26
    55 min

    [oretd-537]めありちゃん

  • amateur censoredcreampiebig titsoretdoretd-537oretd537oretd-537
    • 2019-08-16
    119 min

    [MVSD-397]I Went On A Business Trip And Was Staying At A Rustic Old Hot Springs Inn, And To My Surprise, I Was Placed In The Same Room As This Newly Graduated Female Associate For Some Reverse NTR Action She Shook Her Ass So Furiously That I Was Forc

  • akari neo censoredcreampiebeautiful girlMVSDm s video groupMVSD-397MVSD397mvsd00397
    • 2019-09-08
    119 min

    [IPX-365]"I Never Thought I'd Cum This Much..." She Gets Piston-Fucked Even After She Cums! She Climaxes 154 Times! He Pumps His Cock Into Her 5124 Times! This Is The Most Anyone's Ever Cum In The History Of The World! - Karen Kaede

  • karen kaede censoredbeautiful girlsingle workIPXidea pocketusa pyondishIPX-365IPX365ipx00365
    • 2019-11-02
    210 min

    [NKKD-146]Dash Cam NTR 10 The Dashboard Camera Saw Everything, From Start To Finish

  • censoredmature womanNKKDjet eizoNKKD-146NKKD146nkkd00146
    • 2019-11-05
    137 min

    [SDAB-109]I Was Having Sex All Day Since The Start Of The Afternoon With An Old Man Who Was Older Than My Dad Chiharu Sakurai

  • chiharu sakurai censoredbeautiful girlsingle workSDABsod creategoemonone s youthSDAB-109SDAB1091sdab00109
    • 2019-11-27
    52 min

    230ORETD-574 Haruna-chan (G cup)

  • amateur censoredbig titsuniformoretdoretd-574oretd574230oretd-574
    • 2019-11-30
    118 min

    [RBD-950]Married Woman Works at A Soapland For Her Husband Iroha Natsume

  • natsume saiharu censoredsingle workdramaRBDattackersamazing meatryupakuRBD-950RBD950rbd00950
    • 2019-12-01
    138 min

    [KTB-028]Meaty Attendant! - Confessions Of A Former Cabin Attendant With G-Cup Tits - Yurika Aoi

  • yurika censoredbig titssingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-028KTB028ktb00028
    • 2020-01-15
    196 min

    [PTS-459]The Masochistic Lesbian Awakening Of A High Class Married Woman In An Oil Massage Parlor With Breast Milk Spraying

  • nozomi hazuki sumire seto censoredlesbianPTSpeterssix manPTS-459PTS459h-021pts00459
    • 2020-01-23
    43 min

    FC2PPV 1254075 [Raw Saddle Creampie / God Tech Bella Cum Shot] Hamabe 〇 Wave A Small Devil Who Is Very Similar To Airi Is Completely Tossed And Conceived Creampie W Nipple Blame / God Tech Blow / Pantyhose Handjob / Raw Saddle / Mouth Launch!

  • amateur uncensoredfc2
    • 2020-02-22
    150 min

    [JUKF-036]This Hard Working Beautiful Girl Was Just Trying To Make Ends Meet But I Persuaded Her To Let Me Take It All The Way In A Raw Sex Session (Current College S*****t) Rental Girlfriend Ichika-chan Ichika

  • kasagi ichika censoredcreampiebeautiful girlJUKFjumpno directorjump avJUKF-036JUKF036h-227jukf00036
    • 2020-02-23
    63 min

    [022320_977]グラマラス 夏木ゆきえ

  • amateur uncensored1pondo
    • 2020-03-15
    108 min

    [DDOB-069]Bondage/Woman Ass Fuck, Kaori Arisue

  • arisue kaori censoredmature womanbdsmDDOBdogmatenunmy auntDDOB-069DDOB069ddob00069
    • 2020-04-11
    119 min

    [SHKD-897]Every Day Is Full Of Sweaty Sex For A Girl With Big Tits Who Lives In The Countryside - Eimi Fukada

  • emi fukada censoredsingle workdramaSHKDattackerskitorune kawaguchisharkSHKD-897SHKD897shkd00897
    • 2020-04-21
    81 min

    261ARA-435 [Cum Beautiful Girl] 22 Years Old [Erotic Amazing Body] Licca-chan Visits! The reason for her application to attend a certain W university is "I’m in a pinch economically and physically … ♪" If you take it off [Slender &a

  • amateur censoredbig titssquirtingaraara-435ara435261ara-435
    • 2020-04-23
    120 min

    [SW-699]Not Only Does She Have Big Tits, She Never Wears A Bra, So Her Titties Are Jiggling And Wiggling And I Can See Them And I Can't Take My Mind Off Of It, And She's Wearing Knee-High Socks And That Total Domain Of Eroticism Is So Allurin

  • censoredbig titsSWswitchswitch switchSW-699SW6991sw00699
    • 2020-05-28
    48 min

    [GRCH-374]The Truth Or Dare Game - Let's Spend Some More Sexy AFTER TIME Together - Alec

  • sakisui honoka wakamiya censoredblowjobGRCHgirl s chhajime yanaiGRCH-374GRCH3741grch00374
    • 2020-06-11
    136 min

    [IESP-665]S*****t Girl's 20 Loads in a Row Creampie Bonanza: Aoi Nakajo

  • nakagusuku censoredcreampieIESPi energychrysanthemumiespIESP-665IESP6651iesp00665
    • 2020-07-02
    66 min

    [KBTV-002]How True Is The Rumor That "Most Nurse Babes Are Horny"？ Is It True That A Nurse On The Night Shift Has More Desire For Sex Or Sleep And Is Easy To Fuck？

  • censoredbig titsamateurKBTVgoing too far tvKBTV-002KBTV002h-1514kbtv00002
    • 2020-07-16
    320 min

    [DVDMS-557]Faces Shown: The One-Way Mirror Car - College Girl Special - 2-Discs, 8 Performances! We Ask: Can Guys And Girls Really Just Be Friends？! Watch Real S*****t Amateurs Get Put To The Test In Japan's Hottest Show On Wheels 13 The First-Ev

  • censoredcreampieamateurDVDMSdeep sthe magic mirrorDVDMS-557DVDMS557dvdms00557
    • 2020-08-12
    65 min

    [tkwa-098]えちか

  • amateur censoredcreampiebig titstkwatkwa-098tkwa098tkwa-098
    • 2020-09-11
    43 min

    [gerk-304]るか嬢

  • amateur censoredcreampiebig titsgerkgerk-304gerk304gerk-304
    • 2020-09-29
    244 min

    [ZOOO-006]Colossal Tits Mature Woman Creampie, 12 People, Nasty Ripe Married Woman, 240 Min.

  • nozomi maezono kaori censoredcreampiebig titsZOOOzoooZOOO-006ZOOO006h-1515zooo00006
    • 2020-10-03
    40 min

    FC2PPV 1521941 [Personal shooting] A plump 38-year-old mature wife who is continuously vaginal cum shot leaves herself to numbing pleasure …

  • amateur uncensoredfc2
    • 2020-10-04
    242 min

    [MMB-325]Amazing Handjob, 20 Shots!!

  • maria nagai emi fukada censoredsluthandjobMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-325MMB325mmb00325
    • 2020-11-13
    234 min

    [MUDR-131]"Hey Mister, Let Me Fuck You" This Girl Loves To Give A Blowjob And Loves To Connect Through Deliciously Ravenous Sex

  • censoredblowjobMUDRmukuMUDR-131MUDR131mudr00131



    • Jav Movie Free Download