titty fuck beautiful tits big jav dmm exclusive




FC2NATRGVHAMBIMILKDASDSSNIPREDPPPDSSISHDKAMVSDMEYDBLKABWADNMARARBDJUFEJULMIDV

2024-05-04
139 min

SQTE-538 Saddle Tide SEX Horikita With A Big Bruise Girl That Can"t Be Hidden And Busty Girls

  • horikita miki sakura mahi censoredbig titsblowjobSQTEs cuteSQTE-538SQTE538sqte00538
    • 2024-05-03
    120 min

    MIDV-740 I Was A Homeroom Teacher, And I Lost The Student"s Temptation And Had Sex Over And Over Again In Love Ho After School ...

  • yoru tsukumo censoredbig titsuniformMIDVmoody ssapporo taromoodyz divaMIDV-740MIDV740midv00740
    • 2024-05-03
    160 min

    CAWD-661 After The Vaginal Cum Shot, The Pursuit Sandwich Marshmallow Mashmaro Boobs Paizuri Stype Square 9 Consecutive Fire Nagisa Shiraishi

  • shiraishi nagisa censoredcreampiebeautiful girlCAWDkawaiinanzaki masakiCAWD-661CAWD661cawd00661
    • 2024-04-18
    108 min

    300MIUM-1048 [G -milk Nasty Juice Covered!!] Slow The Esthetic Reception Busty Big Breasts Beautiful Girl To Chichibu!!She Does Not Show Her Hair To Her Who Loves Her Hair And Breaks Her Hair!!A Sweaty Passion Sexual Intercourse That Strikes Your Wai

  • amateur censoredbig titsamateurmiummium-1048mium1048300mium-1048
    • 2024-04-11
    79 min

    336KNB-298 [Mitsu -Mitomi Wife] Beautiful Body Young Wife Who Is Beautiful From Everywhere!Exposed The Amazing Fascination Of The Tight Body And The Highest Touch Of The Super -obscene H Cup Big Tits And The Best Touch!Such A Young Wife Wants To Be F

  • amateur censoredbig titsmarried womanknbknb-298knb298336knb-298
    • 2024-03-15
    160 min

    EBWH-082 Milk Shaking Dance Videos Have Become Too Famous For Tikt ○ K And Have Erased Their Accounts.

  • kosaka himari censoredbig titsbeautiful girlEBWHe bodykyouseiEBWH-082EBWH082ebwh00082
    • 2024-03-15
    140 min

    MIDV-641 When I Stayed At My Son"s House, Living Together ... I Couldn"t Stand The Innocent Boobs Of My Son"s Kanojo ...Hinano Kuno

  • kuno hinano s censoredbig titsbeautiful girlMIDVmoody strendy yamaguchimoodyz divaMIDV-641MIDV641midv00641
    • 2024-03-15
    140 min

    MIMK-151 Original: Shinko Konoshiro [expressionless X Cool Attack] Mr. Mamiya In The Next Seat-Live-action Version-The Superb With A Cool Busty Beautiful Girl Who Is Approaching The Etch And The Finest Sex That Can Fulfill The Desire And Desire

  • censoredcreampiebig titsMIMKmoody shide monkmankitsuMIMK-151MIMK151mimk00151
    • 2024-03-15
    220 min

    MIDV-626 Perfect Figure Figure -shaped Beautiful Girl And Oji -san, Stay Overnight!Until The Next Morning, I Was Drowning In Middle -aged Tech With A Gonzo, And I Continued To Be Squid.

  • minamata sakura censoredbig titsbeautiful girlMIDVmoody stequilatinomoodyz divaMIDV-626MIDV626midv00626
    • 2024-03-04
    61 min

    259LUXU-1778 Luxury TV 1764 The Transparent Whitening F Cup Is Dazzling!Slut Game Programmers Who Suck Their Favorite Chi -Po Without Mind Are Games And Sex In The Whole Body!

  • amateur censoredbig titsamateurluxuluxu-1778luxu1778259luxu-1778
    • 2024-02-23
    118 min

    RCON-039 Innocent

  • amateur censoredbig titssquirtingrconrcon-039rcon039rcon-039
    • 2024-02-17
    58 min

    CRNX-101 [4K] I Was Made To Cum So Much That I Wanted To Cry By My Master Who Only Felt Disgust... Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsCRNXcrystal picturecrystal nextCRNX-101CRNX101crnx00101
    • 2024-02-17
    130 min

    ONSG-075 Big Tits Delivery Health H Cup Noa Hazuki

  • hazuki notaka censoredcreampiebig titsONSGgain corporationONSG-075ONSG075onsg00075
    • 2024-02-16
    210 min

    PPPE-190 Returning To Okinawa From Tokyo With Sanshin! Hcup Big Breasted Islander Makes A Triumphant Return On The 3rd Anniversary Of Her AV Debut! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPEoppaiPPPE-190PPPE190pppe00190
    • 2024-02-03
    120 min

    AWD-147 Incest Mother"s Ass - Beautiful Stepmother"s Obscene Big Butt And Big Tits Hinami Narisawa

  • hinami narusawa censoredbig titsmature womanAWDrubysusumu yanoguchinext doorAWD-147AWD147awd00147
    • 2024-01-21
    101 min

    300MIUM-1005 [3D Beautiful Big Breasts] Rent An Active Art College Student With Anime Voice And F Cup Beautiful Big Breasts As Your Girlfriend! A Complete Record Of The Entire Story Of How He Seduced Her And Even Performed Erotic Acts That Were Origi

  • amateur censoredcreampiebig titsmiummium-1005mium1005300mium-1005
    • 2024-01-20
    68 min

    SIRO-5203 [Beautiful Big Breasts Titty Fuck] [Little Devil-chan] A Beautiful Girl With A Half-faced Face And Natural Bruises And 100 Cuteness! ! Her Loving Smile Turned Into An Expression That Looked Like She Was About To Cry Due To The Pleasure She

  • amateur censoredbig titsamateursirosiro-5203siro5203siro-5203
    • 2024-01-19
    123 min

    FOCS-171 A Childhood Friend I Met After A Long Time Turned To A Beautiful Girl With An Erotic, Beautiful Big Breasts Body. I Couldn"t Resist The Periscope Titjob From The Protrusion Of The Bathtub, So I Hid From My Parents And Had Sweet Lovemakin

  • miyanishi hikaru censoredbig titsblowjobFOCSabc delusion groupfocusFOCS-171FOCS171focs00171
    • 2024-01-07
    89 min

    300NTK-846 [The Rumored H-cup Lewd Esthetician Appears! ] [Big Breasts! Explosive! So Wet! An Explosive Erection Is Inevitable With Oil Treatment! ! 】【basis! ？ Deep Thrust Acme Crying And Raw SEX! ! ] [This Is A Slut! ! This Is A Slut! ! ] Gachiero B

  • amateur censoredcreampiebig titsntkntk-846ntk846300ntk-846
    • 2023-12-29
    170 min

    MIDV-590 A Tomboyish H-cup College Girl Takes On Her First Exciting Challenge At A Service Soapland Called Erika Isshin.

  • isshin erika censoredbig titsbeautiful girlMIDVmoody skyouseimoodyz divaMIDV-590MIDV590midv00590
    • 2023-12-19
    67 min

    300NTK-847 [H Cup Beautiful Big Breasts Echona Santa! ! ] A Beautiful Woman With A Bombshell Breasts And A Lewd Body Participates! ! Erotic Cosplay And Erotic Time Rush With Rich Service Blowjob And Titty Fuck! ! Cosplay Is Dope♪ Naked Raw Insertion

  • amateur censoredcreampiebig titsntkntk-847ntk847300ntk-847
    • 2023-11-28
    89 min

    261ARA-587 [Beautiful Gal] [Beauty MAX] A Beautiful Woman Overflowing With Eroticism Appears! The Reason For Applying Is ``I Want To Be Sexy♪"" If You Squeeze It, You"ll Become Beautiful! ？ Super Erotic Monster Goes Wild With Sperm Exploi

  • amateur censoredbig titsamateuraraara-587ara587261ara-587
    • 2023-11-27
    62 min

    SIRO-5184 [Both Men And Women Like It] A Beautiful Mature Woman With An Outstanding Style That Doesn"t Look Like She"s Around 40! I Can"t Stop Feeling Excited After Having Sex For The First Time In A While! ! [First Shoot] AV Application

  • amateur censoredbig titsmarried womansirosiro-5184siro5184siro-5184
    • 2023-11-27
    110 min

    300MIUM-1007 [Amazingly Beautiful Waist X Huge Breasts] A Plump G Cup! ! A Leisure Trip To Enjoy Nature In Yamanashi With A Nursery Teacher With A Two-dimensional Body! ! 2nd Round Of Intense SEX With Boobs Shaking And Big Orgasms With A Perfect Scor

  • amateur censoredcreampiebig titsmiummium-1007mium1007300mium-1007
    • 2023-11-16
    58 min

    SIRO-5174 [H Cup Is H For Happiness] Swaying And Swaying Boobs! I"ve Been To The Hap Bar And Have Done It In The Multi-purpose Toilet, And I"m Going To Devour The Beautiful JD With A Lot Of Experience! ! [First Shoot] AV Application Online →

  • amateur censoredbig titsamateursirosiro-5174siro5174siro-5174
    • 2023-11-08
    282 min

    718FZR-016 AV Actress Working Hard Maya Kikuchi

  • amateur censoredbig titsamateurfzrfzr-016fzr016718fzr-016
    • 2023-11-12
    107 min

    300MIUM-1006 [Beautiful White Gal"s Overflowing Breasts] Boing Bouncing Every Time She Walks ♪ A Slacking Trip With An Apparel Store Clerk Who Is Full Of Eroticism! ! After Having Fun, Rub Her Big G Breasts★ The Naughty White Gal Has The Best Sex

  • amateur censoredcreampiebig titsmiummium-1006mium1006300mium-1006
    • 2023-10-31
    63 min

    200GANA-2938 Hidden Video Of Sex With A Veteran Pick-up Artist In His Room 316 Secret Video Of Sex With A Beautiful Half-faced Woman Who Is Fluent In English! She Grew Up Overseas And Has Big Breasts, A Beautiful Butt, And A Fair-skinned Body With A

  • amateur censoredbig titsamateurganagana-2938gana2938200gana-2938
    • 2023-10-28
    67 min

    SIRO-5164 [I Love Fun And Naughty Things] The Most Exciting Play I"ve Ever Had Is Anal Sex ♪ A Beautiful Woman With An Endless Quest For Sex Has Come To Reach Even Higher Heights! Her Sensitive Pussy Holds Her Favorite Cock In Her Mouth And Won&q

  • amateur censoredbig titssquirtingsirosiro-5164siro5164siro-5164
    • 2023-09-30
    130 min

    AWD-145 Incest Mother"s Ass - Beautiful Stepmom Is A Mesmerizing Mass Yukari Ayano

  • ayano yukari censoredbig titsmature womanAWDrubysusumu yanoguchinext doorAWD-145AWD145awd00145
    • 2023-10-20
    92 min

    277DCV-243 Can I Take You Home？ Case.233 [5th Place In The Country! Kanagawa 1st Place] G Cup Super Beautiful Woman! This Cuteness Without Any Processing! Silver Shield YouT●ber Definitely Changed [Ikuiku Fever SP] ⇒ G Cup Spectacular Angle! Divine T

  • amateur censoredbig titsamateurdcvdcv-243dcv243277dcv-243
    • 2023-10-15
    68 min

    SIRO-5159 [A Half-beautiful Woman Who Knows The Essence Of Sex] [You Like This Bat Better Than A Baseball Bat, Right？ ] Once You Experience Sex That Is More Intense Than The Usual Lukewarm Sex, You Won"t Be Able To Escape! [First Shoot] AV Applic

  • amateur censoredbig titssquirtingsirosiro-5159siro5159siro-5159
    • 2023-10-07
    151 min

    SCOP-823 There Is A Rumor That There Is A Girl With Big Breasts Who Forces You To Have An Endless Fuck That Doesn"t End Even If You Pull Out And Pull Out In A Less Popular Alley In A Certain Part Of Tokyo! ! Just When I Thought It Was Over, The C

  • censoredcreampiebig titsSCOPscoopcamelSCOP-823SCOP823scop00823
    • 2023-10-06
    127 min

    BOBB-391 [Confidence Work] These Are The Divine Breasts, The Strongest Breasts Approved By The Boin Master, And We Will Thoroughly ``lick And Suck"" Them To The World"s Breast Fetishists! ! Boin “Ao Hazuki” Box

  • hazuki notaka censoredcreampiebig titsBOBBabc delusion groupboinbb abcBOBB-391BOBB391bobb00391
    • 2023-10-05
    80 min

    336KNB-275 [Hidden Big Breasts X Hidden Lewdness = Super Erotic] ​​A Quiet-looking Wife With A Mature Face. In Fact, She Seems To Be The Type Who Wears Very Thin Clothes, And When She Takes Off Her Clothes, There Are Beautiful Big Breasts! ! ! ! Brui

  • amateur censoredbig titsmarried womanknbknb-275knb275336knb-275
    • 2023-09-05
    65 min

    200GANA-2910 Seriously Flirty, First Shot. 1957 Picking Up A Beautiful Woman On Her Way Home From A Wedding! My Boyfriend And Friends Seem To Be Happy... SEX Negotiations As If To Take Advantage Of Such Loneliness! A Tall, Slender And Beautiful Siste

  • amateur censoredbig titsamateurganagana-2910gana2910200gana-2910
    • 2023-08-15
    77 min

    200GANA-2897 Seriously Flirty, First Shot. 1946 [Really F Cup？ ？ ] [A Beautiful Woman Who Travels Around The World] A Nice Older Sister Who Participated In The Kiss Challenge Over Wraps ♪ Make A Man Swamp With World-wide Boobs And Famous Instruments!

  • amateur censoredbig titssquirtingganagana-2897gana2897200gana-2897
    • 2023-07-08
    211 min

    TNOZ-025 Gachi 5P Large Orgies Big Boobs Big Breasts Wheel 100cm Layer 18 Years Old [Nipple Iki Repeated Super Sensitive & Throat Irama Ezuki Juice Massive Injection] Climax Pee Public De M White Drodo...

  • censoredbig titscosplayTNOZall japan kameko cooperative delusional groupsecond generation brim drinking uncleTNOZ-025TNOZ025tnoz00025
    • 2023-06-22
    82 min

    535LOG-023 [G Cup Since I Can Remember] A Modest Busty Beautiful Girl Aiming To Be A Nurse Is A Boyfriend"s Privilege Gonzo! ! Fluffy Boobs, Natural Man Hair, Cute Panting Voice, Clinging To The Sheets And Trembling Body... Everything Is Cute And

  • amateur censoredcreampiebig titsloglog-023log023535log-023
    • 2023-06-16
    140 min

    EBOD-991 When I Undressed My Girlfriend For The First Time... I Couldn"t Imagine Her Slim Big Tits From Her Clothes, And She Had A Cute Face That I Couldn"t Imagine From Her Glasses.

  • walnut sakura censoredbig titsbeautiful girlEBODe bodyukichiEBOD-991EBOD991ebod00991
    • 2023-06-16
    160 min

    EBOD-987 Divine Breasts Without Exaggeration 3 Month Document Until An Amateur Female College Student With Miraculous Breasts Makes An AV Debut On The Condition Of NG Appearance Noao Hazuki

  • hazuki notaka censoredbig titsEBODe bodymichiru arashiyamaEBOD-987EBOD987ebod00987
    • 2023-06-09
    152 min

    SSIS-742 I Was Invited To Drink At Home By A Beautiful Boss Who Is Rumored To Have A J-Cup... We Continued To Fuck For 3 Days And 3 Nights... Hikaru Nagi

  • nagi hikaru censoredbig titsslutSSISs one number one stylegoemons1 no 1 styleSSIS-742SSIS742ssis00742
    • 2023-06-04
    98 min

    390JAC-169 [Large Amount Of Vaginal Cum Shot] [Natural Beautiful Breasts] [Saddle Crazy Sex Beast] A Beautiful Arasa Who Enjoys Being A Single Person Without A Desire To Get Married. Successful Self-employed Beauty Sales! A Woman Who Can Do It Is Ama

  • amateur censoredcreampiebig titsjacjac-169jac169390jac-169
    • 2023-05-19
    108 min

    277DCV-230 Can I Send You Home？ Case.223 Big Boobs Without Margins [The Best And Most Beautiful K Cup In The Series] Desire Is On The Verge Of Explosion! No Way Reverse Idiot ●! A Real Mermaid Crazy About Men! Black White Big Cock Killer! ⇒ Burst! Go

  • amateur censoredbig titsamateurdcvdcv-230dcv230277dcv-230
    • 2023-05-06
    121 min

    DAVK-081 [Miraculous J-Cup Beautiful Big Breasts] My Perverted Boyfriend'S Ntr Hobby Lent To A Horny Man'S Over 100Cm Soft, Colossal Breasts, Titties, Ejaculation, Shaved Pussy-Pussy/Shaved Pussy/Pussy/Shaved Pussy-Ass Of A First-Seen Man

  • censoredbig titsuniformDAVKdoujin av club delusion tribeyaiba hashida takamitsuDAVK-081DAVK081davk00081
    • 2023-05-05
    116 min

    277DCV-229 Can I Send You Home？ Case.222 [Natural G Milk] Vine! Boyne! Poin! Big, Beautiful, And Firm! High-speed Grind Cowgirl! Breast Shaking Magnitude 10! ⇒ I Like Cosplay! Gachi Uniform Of School Days! Standing Back For Seconds ⇒ A New Interpreta

  • amateur censoredbig titsamateurdcvdcv-229dcv229277dcv-229
    • 2023-04-22
    129 min

    ONSG-063 Busty Deriheru Misuzu Mifune

  • mifune misuzu censoredcreampiebig titsONSGgain corporationONSG-063ONSG063onsg00063
    • 2023-04-22
    100 min

    ANX-153 Back Event Slave Woman # Rika # Fiction # Contract # APEX Rika Aimi

  • rumi tadami censoredbig titsbeautiful girlANXdreamy love daydreaming groupANX-153ANX153anx00153
    • 2023-04-21
    183 min

    HUNTB-562 "Maybe It"s My Fault That I Can"t Concentrate？" My Tutor Is Kind, Beautiful And Super Big! And My Back

  • amateur censoredcreampiebig titsHUNTBhunterHUNTB-562HUNTB562huntb00562
    • 2023-04-14
    236 min

    MKCK-330 When I Take Off My Girlfriend For The First Time... I Can"t Imagine From The Clothes I"m On, I"m Excited, And I"m Fucking Until I Run Out Of Sexual Desire 5 Titles Complete BEST

  • florets ayase kokoro censoredcreampiebig titsMKCKe bodyMKCK-330MKCK330mkck00330
    • 2023-04-14
    122 min

    BOBB-373 Enjoy Plenty Of Natural I Cup Beautiful Big Breasts With A Dazzling Smile In Milk Fetish Play! Boin "Sakura Mita" Box

  • mita sakura censoredcreampiebig titsBOBBabc mousouzokuBOBB-373BOBB373bobb00373
    • 2023-04-14
    120 min

    MIDV-322 First Sleepover Date - Holding Hands, Kissing, Laughing, And Afterwards - Nana Misaki

  • misaki nana censoredbig titsblowjobMIDVmoodyzMIDV-322MIDV322midv00322
    • 2023-04-14
    154 min

    EYAN-195 Former Kanto Local Station Weather Sister Meguru Asahina Who Captivated Men With Gcup Beautiful Big Tits That You Can Understand Even By Clothes AV Lifted After Marriage!

  • morning hina meguru censoredbig titsEYANe bodyEYAN-195EYAN195eyan00195
    • 2023-04-14
    150 min

    HMN-335 While She"s Awake In A Couple"s Private Room Esthetician, She Sleeps With A Slow Piston While She"s Awake, A Beautiful Busty Esthetician Non Kobana

  • florets censoredcreampiebig titsHMNhon nakaHMN-335HMN335hmn00335
    • 2023-03-25
    122 min

    DOA-038 Fair-Skinned, Big-Tits, Soothing Soft, Exquisite Boobs

  • censoredbig titsDOAblack dog delusionDOA-038DOA038doa00038
    • 2023-03-24
    100 min

    300MIUM-879 Let’s! [A Must-See For Those With Bad Erections] [Sweet Beauty X Attractive Body] [F Breasts X Beautiful Buttocks] [Vaginal Pressure Gyungyun] Take Home The Muscle Training Yout Ber With Over 110,000 Registrants! A Raging Chintre Sex

  • amateur censoredbig titsamateurmiummium-879mium879300mium-879
    • 2023-03-23
    84 min

    535LOG-017 [An Elegant Face That Melts With Alcohol And Sex] A Perfect Knit With Bare Big Breasts Is A Big Jug! ! "Put Out A Lot ♪" With A Red Face Is Too Great! ! If A Amazing Beautiful Woman Is Amazingly Erotic, Her Cock Will Revive Again A

  • amateur censoredcreampiebig titsloglog-017log017535log-017
    • 2023-03-21
    73 min

    300MIUM-880 Enchanting Erotic Body [pita Bread Beautiful Big Butt X Beautiful Huge Breasts F Cup] "If You Join Our Community, You Can Get Everything ♪" Nico Nico Recommends Protein & Membership, But Somehow Hotain! It"s Amazing When You T

  • amateur censoredbig titsamateurmiummium-880mium880300mium-880
    • 2023-03-18
    92 min

    563PPZ-017 [F Cup In Middle School / Current I Cup] Beautiful Huge Breasts Amateur With A Half-talent Face! ! Blame The Erogenous Zone Nipples And Mako! ! Experience The Ultimate Fucking Of Happiness Level MAX! ! [Boob Zuriko. ]

  • amateur censoredbig titssquirtingppzppz-017ppz017563ppz-017
    • 2023-03-14
    105 min

    261ARA-563 [Huge Breasts And Boobs] [God Milk] "I Came To Take An Etch Course To Satisfy My Favorite Boyfriend W" How Erotic Am I？ Pursue Eroticism For Those Who Like It, Such As Experiments! I Think It"s Okay If You Don"t Have To Go

  • amateur censoredcreampiebig titsaraara-563ara563261ara-563



    • Jav Movie Free Download