slut censored high vision grimosa javcensored




FC2ATIDSTARSROYDNATRSPRDMIDVNNPJBLKMIAADASDAWDDASDVEMAGMEMFSDSSKBISSNIVENXPPPDHMN

2020-12-17
157 min

[SSNI-943]Massage Parlor Slut Will Bust Your Nut With Her Incredible Hand And Tongue Techniques Ichika Hoshimiya

  • ichika hoshimiya censoredsquirtingsingle workSSNIs1 no 1 stylemonSSNI-943SSNI943ssni00943
    • 2020-12-05
    148 min

    [SSNI-928]If I Have To Choose Between Tits And Something Important, I'll Choose Tits Every Time Saki Okuda

  • saki okuda censoredbig titsslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-928SSNI928ssni00928
    • 2020-11-06
    124 min

    [SSNI-905]The Married Woman Next Door Moved In And Now I've Been Deluged With Orgasmic Sex Minami Kojima

  • minami kojima censoredslutsingle workSSNIs1 no 1 stylebieber gonzoSSNI-905SSNI905ssni00905
    • 2020-11-06
    119 min

    [SSNI-910]This Boyish Barely Legal After-School Club Girl And A Middle-Aged Coach Are Rooming Together During Summer Training Camp... And This Female S*****t Is So Horny That She Paid Him A Reverse Night Visit And Hit Him With 10 Rounds Of Orgasmic E

  • kodama rena censoredbig titsbeautiful girlSSNIs1 no 1 stylerokusaburo mishimaSSNI-910SSNI910ssni00910
    • 2020-11-06
    172 min

    [SSNI-912]Yura And Izuna Love Middle-Aged Men, And Their Lecherous Father-In-Law Loves Young Hotties! Yura Kano & Izuna Maki

  • yura kanno izuna maki censoreduniformslutSSNIs1 no 1 stylemichiru arashiyamaSSNI-912SSNI912ssni00912
    • 2020-10-17
    153 min

    [SSNI-891]Seduced By My Immoral Stepsister... She Just Got Hitched But She Couldn't Be Hornier - Sex With My Raging Nympho Stepsister All Over The House Yura Kano

  • yura kanno censoreduniformslutSSNIs1 no 1 stylegoemonSSNI-891SSNI891ssni00891
    • 2020-10-17
    115 min

    [SSNI-889]It's Been Ten Years Since My Home Room Teacher Took My Virginity And Turned My World Upside-Down. Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 styletrendy yamaguchiSSNI-889SSNI889ssni00889
    • 2020-10-03
    117 min

    [SSNI-880]My Neighbor Is A College Girl Who Moved In Across The Way, And Now, Even Though I'm Married, I'm Drowning In The Pleasure Of Orgasmic Sex With Her Miharu Usa

  • miharu hanasaki censoredbig titsslutSSNIs1 no 1 stylebungo maedaSSNI-880SSNI880ssni00880
    • 2020-10-03
    120 min

    [SSNI-879]"Let's Take A Break At That Hotel" I Was Dead Tired, So My 2 Lady Bosses Took Care Of Me And We Had Ourselves A Fully Nude After Party While They Made Me Ejaculate Until My Balls Went Dry Tsukasa Aoi Minami Kojima

  • tsukasa aoi minami kojima censoredslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-879SSNI879ssni00879
    • 2020-09-17
    120 min

    [SSNI-870]My Step-Niece, Who Is Going Through Puberty, Takes My Cock Into Her Mouth Like A TSUNDERE Slut Every Time Our Eyes Meet, Even In Situations Where We Can't Afford To Get Caught - Mako Ito

  • iga mako censoredschoolgirlbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-870SSNI870ssni00870
    • 2020-08-15
    149 min

    [SSNI-853]S1 2 Top Hot Big Tits Double Performance, I Was Making Out With This H Cup Girl And A J Cup Girl Joined In For A Double Huge Tits Fuck Comparison Dream FFM Threesome, Mei Washio, Saki Okuda

  • mei washio saki okuda censoredbig titsslutSSNIs1 no 1 styletrendy yamaguchiSSNI-853SSNI853ssni00853
    • 2020-08-15
    173 min

    [SSNI-845]My Girlfriend's Big Sister Is Beautiful And Has Big Tits And She's A Sadistic Bitch Too! And Since I'm A Maso Man, I Let Her Have Her Way With Me With Massively Extravagant Maso Sensual Plays Yua Mikami

  • yua mikami censoredbig titsslutSSNIs1 no 1 stylekyoseiSSNI-845SSNI845ssni00845
    • 2020-08-15
    119 min

    [SSNI-833]A Massage Parlor Therapist Who Loves To Make Men Ejaculate Is Hitting You With Exquisite Hand Technique And Big Ass Pussy-Pounding Cowgirl Sex To Make You Cum Twice And It's Oh So Nice Amin Niina

  • new name amin censoredslutsingle workSSNIs1 no 1 stylehirokoji osakiSSNI-833SSNI833ssni00833
    • 2020-08-15
    119 min

    [SSNI-848]This Girl Doesn't Look She Knows Anything About Sex But She'll Service You With A Smile And Give You All Sorts Of Secret Optional Frills Without Asking For Permission In This Absolutely Satisfaction Guaranteed Uniform Reflexology Sa

  • yura kanno censoreduniformbeautiful girlSSNIs1 no 1 stylezaku araiSSNI-848SSNI848ssni00848
    • 2020-07-16
    155 min

    [SSNI-830]3cm Below Her Crotch - A Seductive Nurse With Beautiful Legs In A Tight Miniskirt - Ichika Hoshimiya

  • ichika hoshimiya censoredslutsingle workSSNIs1 no 1 styleamazing meatSSNI-830SSNI830ssni00830
    • 2020-07-16
    120 min

    [SSNI-827]My Brother's Slutty Ex-Girlfriend Is Out Of Control Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-827SSNI827ssni00827
    • 2020-06-14
    189 min

    [SSNI-803]Tsukasa Aoi And Her Cherry-Popping Delivery Service!! She'll Start With Deep And Rich Kisses And Then Go Into First-Time Insertions As She Takes Total Control In This Cherry Boy Graduation Service

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 styletrendy yamaguchiSSNI-803SSNI803ssni00803
    • 2020-06-06
    120 min

    [SSNI-794]There's Nothing To Do In The Summer When You're Out In The Country, So I Had Sweaty, Slow Sex With The Big Tits Elder Sister Type Who Lived Next Door When She Lured Me To Temptation Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-794SSNI794ssni00794
    • 2020-06-06
    118 min

    [SSNI-801]Talented Twerking Slut Rena Kodama's Full-Fuck Cowgirl Fucking

  • kodama rena censoredsquirtingbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-801SSNI801ssni00801
    • 2020-05-02
    153 min

    [SSNI-773]The S1 Fan Thanksgiving Day The Colossal Tits Adult Video Idol Shion Yumi Will Be Visiting The Home Of An Amateur Today She'll Press Her Tits Up Against You And Unleash Her Powerful Nookie Techniques In A 12 Cum Shot Special

  • evening beauty censoredbig titsslutSSNIs1 no 1 stylezampaSSNI-773SSNI773ssni00773
    • 2020-04-16
    120 min

    [SSNI-765]A Gorgeous Modern Girl Moves To The Country, And Is So Bored That She Gets Slutty With The Middle Aged Dude Nextdoor Amin Nina

  • new name amin censoredbeautiful girlslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-765SSNI765ssni00765
    • 2020-04-04
    119 min

    [SSNI-751]My Girlfriend's Sexy Older Sister Secretly Seduced Me With Dirty Talk And I Ended Up Cheating Sora Amagawa

  • tenkawa sora censoredslutsingle workSSNIs1 no 1 stylemon cSSNI-751SSNI751ssni00751
    • 2020-02-15
    119 min

    [SSNI-712]The New Girl At Work And Her Middle-Aged Supervisor End Up Sharing A Room On A Business Trip...She Rides Him Cowgirl Style All Night Amin Niina

  • new name amin censoredbeautiful girlslutSSNIs 1 number one stylemaeda bungos1 no 1 styleSSNI-712SSNI712ssni00712
    • 2020-02-15
    183 min

    [SSNI-710]A Full-Body Buttery Celebrity Lures A Middle-Aged Man To Temptation For Hard And Tight Deep Kissing Sex Marin Hinata

  • marin hinata censoredslutsingle workSSNIs 1 number one stylegoemons1 no 1 styleSSNI-710SSNI710ssni00710
    • 2020-01-16
    119 min

    [SSNI-678]Non-Stop! 10 Cumshots! Dribbling Spit And Drool! Deep Kissing Orgasms That Would Make Your Brain Melt! - Inviting A Slut To Have Sex - Nene Yoshitaka

  • nine yoshitaka censoredblowjobslutSSNIs1 no 1 stylekyoseiSSNI-678SSNI678ssni00678
    • 2019-11-14
    118 min

    [SSNI-622]This Man Is Tied Up And Unable To Move As This Healthy Slut With A Beautiful Body Keeps On Assaulting Him With A Smile As She Fully Controls His Ejaculations Nene Yoshitaka

  • nine yoshitaka censoredslutsingle workSSNIs one number one stylecrests1 no 1 styleSSNI-622SSNI622ssni00622
    • 2019-11-02
    479 min

    [OFJE-220]Ichika Hoshimiya Her First Best Hits Collection It's The First Anniversary Of Her S1 Debut Her Newest 11 Titles 8-Hour Special

  • ichika hoshimiya censoredblowjobslutOFJEs1 no 1 styleOFJE-220OFJE220ofje00220
    • 2019-11-02
    118 min

    [SSNI-606]There Was Nothing To Do In The Country This Summer, So I Let The Big Tits Wife From Next Door Lure Me To Temptation And Had Sweaty, Slow Sex Every Single Day Sai Okuda

  • saki okuda censoredbig titsslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-606SSNI606ssni00606
    • 2019-11-02
    150 min

    [SSNI-612]A Beautiful Young Girl And A Middle-Aged Man Engage In Extreme, Vulgar Tongue-Kissing And Sex - Nodoka Sakuraba

  • sakuraha nodoka censoredbig titsblowjobSSNIs one number one styleusapyons1 no 1 styleSSNI-612SSNI612ssni00612
    • 2019-10-12
    119 min

    [SSNI-590]"You're Always Looking At Me, Right？" - She Smiles Sweetly, Wearing Her School Swimsuit... She Knows Everything Already... She's Ready To Turn The Tables On You! - Nami Hoshino

  • nami hoshino censoredslutsingle workSSNIs1 no 1 stylekyouseiSSNI-590SSNI590ssni00590
    • 2019-10-12
    161 min

    [SSNI-592]Reverse Violation Slut Makes A Man Continuously Ejaculate While He Can't Get Away! Aika Yumeno

  • yumeno aika censoredbig titsslutSSNIs1 no 1 styleusapyonSSNI-592SSNI592ssni00592
    • 2019-10-12
    118 min

    [SSNI-594]In The School Library, That Bookworm Girl Started Giggling While She's Tied Up And Can't Move... Nene Yoshitaka

  • nine yoshitaka censoredbeautiful girlslutSSNIs1 no 1 stylekyouseiSSNI-594SSNI594ssni00594
    • 2019-10-12
    180 min

    [SSNI-591]This Sexual Salon Offers Exciting Dirty Talk Therapy And Slow, Relaxing Sex - Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 stylehiroharu osakiSSNI-591SSNI591ssni00591
    • 2019-10-12
    149 min

    [SSNI-589]Noa Mikami Is Cumming With All Her Might

  • yua mikami censoredbig titsslutSSNIs1 no 1 stylecrestSSNI-589SSNI589ssni00589
    • 2019-10-12
    150 min

    [SSNI-603]FANZA Award Winning Actress Is A Gorgeous Co-Star! Up, Down, Behind, Left, Right, Getting Slutty Simultaneously! 360 Degree Pleasure MAX Dream Reverse 3P

  • angel moe see the slope censoredbeautiful girlslutSSNIs1 no 1 stylemon cSSNI-603SSNI603ssni00603
    • 2019-10-03
    479 min

    [OFJE-216]Nene Yoshitaka S1 Debut 2nd Anniversary Best Hits Collection Her Latest 12 Titles 64 Episodes 480-Minute Special

  • nine yoshitaka censoredbeautiful girlslutOFJEs1 no 1 styleOFJE-216OFJE216ofje00216
    • 2019-09-05
    165 min

    [SSNI-556]She Straddles Me Right Next To My Wife - Big Sister's Secret Seduction Minami Kojima

  • minami kojima censoredslutsingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-556SSNI556ssni00556
    • 2019-09-05
    166 min

    [SSNI-555]I Can See My Girlfriend's Sister's Panties! My Girlfriend Is Right Next To Us But Her Slutty Older Sister Brazenly Tries To Seduce Me! Moe Amatsuka

  • angel moe censoredslutsingle workSSNIs1 no 1 stylegoemonSSNI-555SSNI555ssni00555
    • 2019-07-13
    119 min

    [SSNI-521]Nympho Teacher Sleeps With Parents & Guardians In Miniskirt Temptation

  • nine yoshitaka censoredslutsingle workSSNIs1 no 1 stylekyoseiSSNI-521SSNI521ssni00521
    • 2019-07-13
    120 min

    [SSNI-518]While My Boss Was Away On A Business Trip, I Fucked The Shit Out Of The Boss's Wife For 3 Whole Days. Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-518SSNI518ssni00518
    • 2019-07-13
    147 min

    [SSNI-517]"I Came So Much I Have No Idea What's Going On..." Her Pussy Was Twitching And Trembling After Cumming, But Then She Got A Second Helping Of Relentless And Furious Piston-Pounding Sex Nami Hoshino

  • nami hoshino censoredslutsingle workSSNIs1 no 1 styledragon nishikawaSSNI-517SSNI517ssni00517
    • 2019-07-04
    168 min

    [SSNI-509]Shameless Fuck After Abstinence, Miru Sakamichi

  • see the slope censoredsquirtingbeautiful girlSSNIs1 no 1 stylexavier thomasSSNI-509SSNI509ssni00509
    • 2019-06-15
    173 min

    [SSNI-497]Devilish Beautiful Legged Female Teacher Always Tempts Me With Her Pantyhose Even Though She's A New Hire Arina Hashimoto

  • there is hashimoto censoredslutsingle workSSNIs1 no 1 stylexavier thomasSSNI-497SSNI497ssni00497
    • 2019-06-15
    160 min

    [SSNI-495]Complete Control Ejaculation Treatment Of Paralyzed Patient And Nympho Nurse Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 stylemon cSSNI-495SSNI495ssni00495
    • 2019-06-15
    121 min

    [SSNI-499]Yura Kano's Slut Teasing Back To Back 16 Cumshots, Forced Cumshot Technique Leaves Tied Up Men Dry

  • yura kanno censoredbeautiful girlslutSSNIs1 no 1 stylek westSSNI-499SSNI499ssni00499
    • 2019-06-15
    119 min

    [SSNI-494]"I Always Want Things Others Have..." Wedding Planner Cheaters With Man Right Before Wedding Nami Hoshino

  • nami hoshino censoredbig titsslutSSNIs1 no 1 styletake dSSNI-494SSNI494ssni00494
    • 2019-06-01
    118 min

    [SSNI-485]To Whom It May Concern, I (A Man Who Loves His Wife) Coveted My Unfriendly And Bookish Neighbor (With Huge Tits) While Away On Business And Ended Up Fucking Her. Aoi

  • censoredbig titsslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-485SSNI485ssni00485
    • 2019-06-01
    151 min

    [SSNI-483]Hot Slut's Filthy Sloppy Kiss Fuck Minami Kojima

  • minami kojima censoredsluthandjobSSNIs1 no 1 styleusa pyonSSNI-483SSNI483ssni00483
    • 2019-06-01
    153 min

    [SSNI-489]Slut Explodes After No Sex Or Masturbation For One Month! Mind Blowing Orgasms Bring Her To The Edge Of Sanity Rikka Inui

  • dry censoredsquirtingsingle workSSNIs1 no 1 styleichigoharaSSNI-489SSNI489ssni00489
    • 2019-05-16
    124 min

    [SSNI-477]A Perverted Young Lady Will Intimately Ride You At High Speed. Nene Yoshitaka

  • nine yoshitaka censoredsquirtingbeautiful girlSSNIs1 no 1 styleichigoharaSSNI-477SSNI477ssni00477
    • 2019-05-16
    122 min

    [SSNI-475]She Intentionally Gave The Slut Treatment To A Man She Hated And Fucked Him Anyway Aika Yumeno

  • yumeno aika censoredbig titsslutSSNIs1 no 1 styleichigoharaSSNI-475SSNI475ssni00475
    • 2019-05-04
    145 min

    [SSNI-466]A Luscious And Abundant Lotion-Lathered Sticky Slut Technique Assault For Consecutive Ejaculatory Sex 12 Consecutive Cum Shots Aoi

  • censoredbig titsslutSSNIs1 no 1 styleichigoharaSSNI-466SSNI466ssni00466
    • 2019-05-04
    140 min

    [SSNI-465]This Big Tits Scientist Elder Sister Will Be Collecting Sperm Samples Using Her Titty Fuck Technique And Has Been Forcing Me Into Massive Ejaculations Every Day Saki Okuda

  • saki okuda censoredbig titsslutSSNIs1 no 1 stylekogoro kindaichiSSNI-465SSNI465ssni00465
    • 2019-03-06
    301 min

    [SSNI-420]Akiho Yoshizawa 's Last Porno Before Retirement

  • akiho yoshizawa censoredslutdeepthroatSSNIs1 no 1 stylexavier thomasSSNI-420SSNI420ssni00420
    • 2019-02-16
    181 min

    [SSNI-417]S1 x MOODYZ Minami Kojima Minami Hatsukawa An Ultra Deluxe Gorgeous Pairing! You Won't Be Able To Move In This Double Minami Slut Fuck Fest Dream Cum True Premium Reverse Slut Threesome Special

  • minami kojima hatsukawa minami censoredslutSSNIs1 no 1 stylegoemonSSNI-417SSNI417ssni00417
    • 2019-02-02
    152 min

    [SSNI-401]The Arrogant Dirty Talk And Semen Vacuum Cowgirl Of A Lascivious Intellectual Slut - Saki Okuda

  • saki okuda censoredbig titsslutSSNIs1 no 1 stylenao masakiSSNI-401SSNI401ssni00401
    • 2019-01-17
    124 min

    [SSNI-388]Yua Mikami In A 16-Consecutive Cum Shot Slut Assault She's Tied Up Men For Some Energy-Sucking Forced Ejaculations

  • yua mikami censoredbig titsslutSSNIs1 no 1 styleichigoharaSSNI-388SSNI388ssni00388
    • 2018-12-29
    182 min

    [SSNI-380]Total Domain: Tempting Glances of Moe Amatsuka's Heavenly, Smooth Thighs

  • angel moe censoredbeautiful girlslutSSNIs1 no 1 stylegoemonSSNI-380SSNI380ssni00380
    • 2018-12-13
    162 min

    [SSNI-369]The Sexy And Kind New Nurse Takes Control And Fucks A Patient Who Is Unable To Move. Arina Hashimoto

  • there is hashimoto censoredbeautiful girlslutSSNIs1 no 1 stylenao masakiSSNI-369SSNI369ssni00369
    • 2018-11-03
    147 min

    [SSNI-335]A Literary Girl Ties Me Up So I Can't Resist And Molests Me With A Smile On Her Face. Moe Amatsuka

  • angel moe censoredbeautiful girlslutSSNIs1 no 1 stylekyoseiSSNI-335SSNI335ssni00335



    • Jav Movie Free Download