shame creampie javcensored censored humiliation

FC2MIAACESDHNDGVHMILKAWDSPRDMEYDDTTBLKADNFSDSSCAWDMVSDNGODWAAAVENXHUNTBPREDEBOD

2023-12-01
120 min

MIDV-551 The Defenseless Big-boobed Female Teacher Is Our Breast Urinal, Bukkake Creampie Rape, 17 Group Pistons, Sticky Semen Humiliation, Riho Shishido

  • shishido riho censoredsingle workMIDVmoody sgoemonmoodyz divaMIDV-551MIDV551midv00551
    • 2022-02-19
    117 min

    [NCYF-015]A Seriously Six-Way Large Orgies Fuck Fest That Will Awaken A Tsundere Princess" True Maso Nature! We"re At A Selfie Session Gathering Featuring A 19-Year Old Beautiful Cosplayer Who Traverses The World Of Underground Idols (Guys Wi

  • censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversudagawaNCYF-015NCYF015ncyf00015
    • 2022-01-28
    119 min

    [WAAA-139]客がいなくなる度に大嫌いな店長が何度も何度も即ズボ中出し！ エスカレートする度に快感に目覚めて時短イキNTR つぼみ

  • bud censoredcreampiesingle workWAAAwanz factorywanzWAAA-139WAAA139waaa00139
    • 2021-01-16
    239 min

    [HUNTA-932]She Brought A Video Camera Along On Our First Date To Remember It By, But When We Got Grabbed By A Couple Of Street Toughs They Used It To Record Fucking Her. I Was So Scared I Couldn't Move A Muscle...

  • censoredcreampieHUNTAhunterspace nyanjirohhh groupHUNTA-932HUNTA932hunta00932
    • 2020-11-07
    140 min

    [URKK-032]While My Father (He's The Director Of A Hospital) Was Away, And As My Boyfriend Sat Beside Me, This Creepy Doctor Kept Creampie Fucking Me, And He Kept Making Me Cum Sachiko

  • sachiko censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-032URKK032urkk00032
    • 2020-10-23
    121 min

    [NEM-047]True/Abnormal Sexual Intercourse, Family Fun With A 50-something Mother, Taking A Big Semen Bukkake From Her Rebellious Step-son - Yumiko Sakura

  • yumiko sakura censoredcreampiebig titsNEMglobal media entertainmentjiro sadogashimanewmomNEM-047NEM047143nem00047
    • 2020-10-23
    120 min

    [NEM-046]Unnatural Sex 50-Something With Not Her Son The Mother Who Was Loved By Her 50-Something Husband And The Cock Of The Other Man Of The House Tsubaki Amano

  • amano tsubaki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-046NEM046143nem00046
    • 2020-10-17
    137 min

    [HUNBL-017]After School Face Fucking: Huge Loads

  • censoredcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-017HUNBL017hunbl00017
    • 2020-09-25
    120 min

    [NEM-043]Seriously Freaky Sex - Stepson And Stepmom In Her Fifties Part Seven - He Was Bullied When He Was Younger, And Now His Stepmom Indulges His Truly Twisted Kinks... Chisato Shoda

  • shota chisato censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-043NEM043143nem00043
    • 2020-09-25
    121 min

    [NEM-044]Forbidden Sex With The Bride's Mother Chapter Fifteen I Like My Stepmom Better Than My Wife... Sachiko Ono

  • sachiko ono censoredcreampiebig titsNEMglobal media entertainmentjiro sadogashimanewmomNEM-044NEM044143nem00044
    • 2020-09-11
    243 min

    [NASH-358]Squirting Fuck!! Mature Woman Tied Hard Fuck Huge Squirt Spray!! 5 Girls 4 Hours

  • maiko kashiwagi yu kawakami morino morino censoredcreampiebig titsNASHnadeshikoNASH-358NASH358h-067nash00358
    • 2020-08-28
    120 min

    [NEM-042]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Sixteen A Stepmom Is Pleasured By Her Stepson's Thick Jellyroll Misato Shibasaki

  • misato shibasaki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-042NEM042143nem00042
    • 2020-08-07
    142 min

    [YMDD-201]夜●い 深夜の寝取られ床上手おんな～旦那の隣で声も出せずに絶頂体験～

  • natsuko mishima aoi kururugi censoredcreampieYMDDmomotarou eizou shuppanasakusa ga jirojaku momoYMDD-201YMDD201ymdd00201
    • 2020-07-24
    120 min

    [NEM-041]True Strange Desires Stepmom In Her 50s And Stepson No.15 Cherry Boy Stepson Goes Deep Into A Ripe Pussy Orie Maya

  • orie maya censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-041NEM041143nem00041
    • 2020-07-24
    120 min

    [NEM-040]True Strange Desires Stepmom In Her 40s And Stepson No.12 Proud Masochist Stepmom Breaking In Her Stepson Shoko Ueki

  • shoko ueki censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-040NEM040143nem00040
    • 2020-06-26
    120 min

    [NEM-037]Forbidden Sex With The Bride's Mother Chapter Eighteen I Like My Stepmom Better Than My Wife... Tomoka Takase

  • tomoka takase censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-037NEM037143nem00037
    • 2020-06-26
    242 min

    [NASH-315]Stepmother/Stepson Fucking In The Country A Lusty Son's Cock Is Pumping His Skinny Stepmom's Pussy

  • kaho eriko matsuo censoredcreampiebig titsNASHnadeshikoNASH-315NASH315h-067nash00315
    • 2020-06-12
    243 min

    [NASH-306]The Bride's Mother, Forbidden Immoral Creampie Fuck

  • michiko uchihara yuri hoshino censoredcreampiebig titsNASHnadeshikoNASH-306NASH306h-067nash00306
    • 2020-05-29
    120 min

    [NEM-035]True Abnormal Sex Stepson And Stepmom In Her 40s No.10 Slender Stepmom Takes In And Indulges In Her Stepson's Cock Yukiko Matsunaga

  • yukiko matsunaga censoredcreampiemature womanNEMglobal media entertainmentjiro sadogashimanewmomNEM-035NEM035143nem00035
    • 2020-05-29
    120 min

    [NEM-036]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Thirty-Three An Alluring Stepmother Who Stimulates Her Stepson's Lust

  • hoka nakayama censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-036NEM036143nem00036
    • 2020-05-29
    120 min

    [NEM-034]Forbidden Sex With The Bride's Mother Chapter Thirty-Three I Like My Stepmom Better Than My Wife... Rieko Hiraoka

  • rieko hiraoka censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-034NEM034143nem00034
    • 2020-04-24
    120 min

    [BRK-023]A Maso Stepmom Who Moans And Groans With Pleasure For Her Stepson's Breaking In Training A Horny Stepmom Gets Tied Up And Tweaked With Sex Toys A Widow Gets Pumped Full Of Aphrodisiacs Threesome Sex With An Obedient Cum Bucket Stepmom

  • emi toda fumiko otowa censoredcreampiemature womanBRKglobal media entertainmentjiro sadogashimabreaking global media entertainmentBRK-023BRK023143brk00023
    • 2020-04-24
    120 min

    [NEM-033]Genuine, Abnormal Sex A Forty-Something Stepmom And Her Stepson Chapter Nine She's The Madam Of An Inn And She Can Feel How Much Her Stepson Has Grown With Her Pussy Sachiko Ono

  • sachiko ono censoredcreampiebig titsNEMglobal media entertainmentsarjinewmomNEM-033NEM033143nem00033
    • 2020-04-24
    120 min

    [NEM-032]Forbidden Sex With The Bride's Mother Chapter Twelve I Like Fucking My Stepmom Better Than My Wife... Emi Toda

  • emi toda censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-032NEM032143nem00032
    • 2020-04-16
    194 min

    [AP-762]When This Married Woman Finally Gave In To The Escalating Sexual Advances Of A Male S*****t Working Part-Time, He Turned Out To Be A Total Stud...

  • censoredcreampieAPapachemasanorihhh groupAP-762AP762ap00762
    • 2020-04-11
    172 min

    [JUFE-165]Double Cum Dumpster: A Record Of The Simultaneous Perversion Training Of Two Big Tittied Young Wives Honoka Mihara Yukino Matsu

  • mihara honoka matsuyuki censoredanalcreampieJUFEfitchJUFE-165JUFE165jufe00165
    • 2020-03-27
    120 min

    [NEM-031]Forbidden Sex With The Bride's Mother: Part 11 - My Mother-In-Law's Even Better Than My Wife. Toshiyo Kitamura

  • toshiyo kitamura censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-031NEM031143nem00031
    • 2020-03-27
    121 min

    [NEM-030]True Abnormal Sex: 40-Something Step-Mother And Step-Son: Part 8 - Perverted Step-Mother Takes Her Step-Son's Virginity: Momoka Anno

  • momoka anno censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-030NEM030143nem00030
    • 2020-03-05
    235 min

    [AP-750]Creampie Counterattack On A High School Bully!

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-750AP750ap00750
    • 2020-02-28
    120 min

    [NEM-029]Genuine, Abnormal Sex A Forty-Something Stepmother And Stepson Chapter Seven Arisa Nishimura

  • nishimura arisa censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-029NEM029143nem00029
    • 2020-01-31
    120 min

    [NEM-026]Genuine Abnormal Sex A Fifty-Something Stepmother And Her Stepson Chapter Eleven Two Stepsons Desire Their Ripe Stepmother Mari Aoi

  • mari aoi censoredcreampiebig titsNEMglobal media entertainmentkikujiro akabanenewmomNEM-026NEM026143nem00026
    • 2020-01-31
    121 min

    [NEM-025]Real Extraordinary Sex - A Stepmom In Her 50's - A Secret She'll Take To Her Grave - Iroha Fukuyama

  • fukuyama iroha censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-025NEM025143nem00025
    • 2020-01-31
    120 min

    [NEM-027]Genuine Abnormal Sex A Forty-Something Stepmom And Her Stepson Chapter Six A Mistake Committed Late In The Night... Ayame Ichinose

  • ichinose ayame censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-027NEM027143nem00027
    • 2020-01-16
    204 min

    [AP-732]A Beautiful Stepsister Comes To Her Stepbrother's Rescue When He Gets Caught Shoplifting, And She Gets Fucked By The Shopkeeper Right In Front Of His Eyes

  • censoredcreampieAPapachemasanorihhh groupAP-732AP732ap00732
    • 2019-12-27
    120 min

    [NEM-022]Real - Strange Sex 50 Year Old Stepmom No. 9 Stepmom Takes Her Nerd Stepson's Cherry Midori Kurashina

  • kurashina midori censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-022NEM022143nem00022
    • 2019-12-26
    492 min

    [NHDTB-353]Natural High 20th Anniversary Special Creampie Reunion 4 A 2-Disc 8-Hour Special With All New Scenes!

  • censoredcreampieNHDTBnatural highjanken kotamaNHDTB-353NHDTB3531nhdtb00353
    • 2019-12-01
    240 min

    [BBACOS-022](Shame) Old Lady Cosplay! (BBA) These Old Housewives Were Dressed As Sailor Warriors And Put To Shame (Creampie Sex)

  • mizuki and good amami bookmark censoredcreampieamateurBBACOSplumpostingshirouto only plumBBACOS-022BBACOS022h-113bbacos00022
    • 2019-11-27
    240 min

    [ODVHJ-031]"Please Stop!" That's What They Said, But When These Married Woman Babes Got Their Sensual Nipples Toyed With By A Rough Sex-Loving Monster And Assaulted By His Ultra Amazing Techniques, They Gave In To The Pleasure And Allowed

  • tenzuki kana rin hayama censoredcreampiebig titsODVHJgraffiti japanorgasmODVHJ-031ODVHJ03148odvhj00031
    • 2019-11-22
    120 min

    [NEM-020]Genuine Abnormal Sex A Fifty-Something Stepmother And Stepson Chapter Eight Abnormal Daily Life With An Obedient Skinny Stepmom Maki Tominaga

  • maki tominaga censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-020NEM020143nem00020
    • 2019-11-22
    120 min

    [NEM-021]Genuine Abnormal Sex A Forty-Something Stepmama And Her Stepson Chapter Four A Horny Stepmom Who Eases Her Loneliness By Using Her Stepson Yumi Kazama

  • kazama yumi censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-021NEM021143nem00021
    • 2019-11-14
    235 min

    [AP-715]Schoolgirl "Total Domain" Prank Body Measurement

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-715AP715ap00715
    • 2019-10-25
    120 min

    [NEM-018]Real Strange Sex 50 Year Old Stepmother And Daughter No. 7 Kozue Tokita

  • kozue tokita censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-018NEM018143nem00018
    • 2019-10-25
    121 min

    [NEM-019]Real Unusual Sex - A 60-Something Stepmom And Her Stepson - Chapter 3 - Toshiyo Kitamura

  • toshiyo kitamura censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-019NEM019143nem00019
    • 2019-10-25
    120 min

    [SGM-020]Sexual Harassment Reconstruction Drama - Helping With The Housework In Tight Pants - Fuck The Naughty Housekeeper From Behind And Cum Inside Her!

  • rikako oikawa yu imanami censoredcreampiemature womanSGMglobal media entertainmentjiro sadogashimasuper global mediaSGM-020SGM020143sgm00020
    • 2019-10-19
    109 min

    [DASD-591]New Iron Crimson Iron Throne Nozomi Arimura

  • arimura nozomi censoredcreampiesingle workDASDdasDASD-591DASD591dasd00591
    • 2019-10-03
    216 min

    [OYC-279]A Weak-Willed Nurse Who Endures Dismal And Soul-Crushing Sexual Harassment On A Daily Basis, And Just Continues To Take It

  • censoredcreampieuniformOYCoyashoku.companymatildahhh groupOYC-279OYC279oyc00279
    • 2019-09-27
    121 min

    [NEM-016]Real Strange Fucking Stepmom In Her 50s No. 6 Maiko Kashiwagi

  • maiko kashiwagi censoredcreampiebig titsNEMglobal media entertainmentjiro sadogashimanewmomNEM-016NEM016143nem00016
    • 2019-09-27
    120 min

    [NEM-015]Real Strange Fucking Stepmom In Her 60s No. 1 Michiko Uchihara

  • michiko uchihara censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-015NEM015143nem00015
    • 2019-09-27
    121 min

    [NEM-017]Forbidden Sex With The Bride's Mother Chapter Nine I Think I Like My Stepmom Better Than My Wife... Rikako Oikawa

  • rikako oikawa censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-017NEM017143nem00017
    • 2019-08-23
    120 min

    [NEM-012]Truly Strange Sex - A Mother In Her 50's At A Hot Springs Resort Engages In A Steamy Forbidden Relationship - Ayako Otowa

  • fumiko otowa censoredcreampiebig titsNEMglobal media entertainmentsarjinewmomNEM-012NEM012143nem00012
    • 2019-08-03
    238 min

    [AP-681]This Weak-Willed Fresh Face Tight Ass Office Lady Is In Daily Sexual Harassment Hell This Pushover Fresh Face Office Lady Is Always Apologizing, Always Saying, "I'm Sorry" And You Can See Her Panty Lines Clearly...

  • censoredcreampieAPapachemariposahhh groupAP-681AP681ap00681
    • 2019-07-26
    121 min

    [NEM-008]Genuine Abnormal Sex A Fifty-Something Mother And Her Son-In-Law Chapter Four Emiko Ibu

  • emiko ibu censoredcreampiebig titsNEMglobal media entertainmentjiro sadogashimanewmomNEM-008NEM008143nem00008
    • 2019-07-26
    121 min

    [NEM-011]Forbidden Sex With The Bride's Mother Chapter Eight Dear Stepmother... I Like You Much Better Than My Wife Yuki Fukuda

  • yuki fukuda censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-011NEM011143nem00011
    • 2019-07-25
    482 min

    [NHDTB-296]Natural High 20th Anniversary Special - Full Service Blushing Sluts - Girls Get Creampied At Their Part-Time Jobs At The Beach, At The Gas Station, At A Festival, At A Beer Garden - 27 Girls Total, 2 Discs, 480 Minutes Special Edition

  • censoredcreampiesquirtingNHDTBnatural highjacken kodamaNHDTB-296NHDTB2961nhdtb00296
    • 2019-06-28
    120 min

    [NEM-007]Forbidden Sex With Mother-in-Law, Part 7: My Mother-In-Law Is So Much Better Than My Wife Yumi Kazama

  • kazama yumi censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanoneo momNEM-007NEM007143nem00007
    • 2019-06-28
    120 min

    [NEM-006]Real Strange Sex 40 Something Mother And Son No. 1 Eriko Matsuo

  • eriko matsuo censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanoNEM-006NEM006143nem00006
    • 2019-06-28
    121 min

    [NEM-005]Real Strange Sex 50 Something Mother And Son No. 3 Yumi Taniguchi

  • yumi taniguchi censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanoNEM-005NEM005143nem00005
    • 2019-06-28
    121 min

    [NEM-004]Real Strange Sex Special Edition: A 50-something Stepmother and Son on a Hot Springs Trip - Steamy Sex in the Forbidden Bath: Maiko Kashiwagi

  • maiko kashiwagi censoredcreampiebig titsNEMglobal media entertainmentsarjiNEM-004NEM004143nem00004
    • 2019-06-15
    218 min

    [AP-666]Nurse Is In On It So She Can't Run Away! Schoolgirl Sexual Harassment Health Exam Forced Nipple Cumming Molestation

  • censoredcreampieschoolgirlAPapachemasanorihhh groupAP-666AP666ap00666
    • 2019-06-06
    120 min

    [NEM-003]Genuine Abnormal Sex A Fiftysomething Mother And Stepson Extra Edition A Hot Springs Vacation Forbidden Steamy Mother And Stepson Fucking Chisato Shoda

  • shota chisato censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanoNEM-003NEM003143nem00003



    • Jav Movie Free Download