s one number one style




FC2SQTEDASDBLKSDABVENXMILKSHKDHUNTBADNROYDNACXJUFEGVHSANSPRDDTTCHRVMVSDWAAAWANZ

2019-12-28
120 min

[SSNI-671]Amazing Sex With Lala Anzai And Her Divine Breasts, Lets Me Ejaculate 20 Times

  • anzai rara censoredbig titsSSNIs one number one stylesugawaras1 no 1 styleSSNI-671SSNI671ssni00671
    • 2019-12-28
    120 min

    [SSNI-661]This Tiny Girlfriend With Light Skin Is Getting Fucked By My Friend's Enormous Cock And Pressing Down In Cowgirl-Riding Sex And Descending Into The Pleasure Of Cuckold Fucking Minami Kojima

  • minami kojima censoreddramaSSNIs one number one stylek wests1 no 1 styleSSNI-661SSNI661ssni00661
    • 2019-12-28
    150 min

    [SSNI-672]Amateur No. ! Style Amu Hanamiya Porn Debut

  • hanamiya amu censoredbig titssquirtingSSNIs one number one stylecrests1 no 1 styleSSNI-672SSNI672ssni00672
    • 2019-12-14
    130 min

    [SSNI-655]Mixed Body Fluids, Deep Sex - Complete No-cut Special - Amin Niina

  • new name ami censoredbig titssquirtingSSNIs one number one stylecrests1 no 1 styleSSNI-655SSNI655ssni00655
    • 2019-12-14
    120 min

    [SSNI-650]NTR Class Reunion - A Disgusting Video Showing The Wife I Love Cheating With Her Terrible Ex Boyfriend. Ichika Hoshimiya

  • ichika hoshimiya censoredmarried womanSSNIs one number one stylemeats1 no 1 styleSSNI-650SSNI650ssni00650
    • 2019-12-14
    180 min

    [SSNI-646]An Absolute Sure Thing She's Magically Luring Me To Temptation With Her Firm And Voluptuous Thighs A Clothed Big Tits Beautiful Girl In Knee-High Socks Aika Yumeno

  • yumeno aika censoredbig titsSSNIs one number one stylebungo maedas1 no 1 styleSSNI-646SSNI646ssni00646
    • 2019-12-14
    150 min

    [SSNI-657]New Face NO.1 STYLE - Limited Release: Riho Hori, 18 Years And 7 Months Old. A Miracle AV Performance

  • riho hori censoredsquirtingblowjobSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-657SSNI657ssni00657
    • 2019-12-14
    120 min

    [SSNI-647]After A Month Of Celibacy, I Lost My Mind In Adultery Sex With My Girlfriend's Best Friend, While My Girlfriend Was Away For 2 Days Arina Hashimoto

  • there is hashimoto censoredblowjobbeautiful girlSSNIs one number one styleasagiris1 no 1 styleSSNI-647SSNI647ssni00647
    • 2019-12-14
    120 min

    [SSNI-648]A Beautiful Lady Boss And Her Orgasmic Employee Went On A Business Trip And Shared A Hotel Room... When She Teasingly Lured Him To Temptation, He Took It Seriously, And Gave Her 10 Ejaculations Of Orgasmic Sex Nene Yoshitaka

  • nine yoshitaka censoredblowjobSSNIs one number one styleinabars1 no 1 styleSSNI-648SSNI648ssni00648
    • 2019-11-30
    120 min

    [SSNI-643]A Woman With Divine Titties Lala Anzai Her Adult Video Debut Miraculous Huge Tits A 7-Tit-Jamming Special

  • anzai rara censoredbig titsSSNIs one number one stylecrests1 no 1 styleSSNI-643SSNI643ssni00643
    • 2019-11-30
    120 min

    [SSNI-630]This Is A 1-Year Video Record Of How I Was Made To Participate In A Contest To Make Women Cum While Riding The Train Moe Amatsuka

  • angel moe censoredbeautiful girlSSNIs one number one stylesugawaras1 no 1 styleSSNI-630SSNI630ssni00630
    • 2019-11-30
    120 min

    [SSNI-635]Extreme Orgasms - An Erotic Awakening - Having Non-Stop Powerful Sex Until Her Desires Are Satisfied - Hotaru Nogi

  • nogi firefly censoredsquirtingSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-635SSNI635ssni00635
    • 2019-11-30
    150 min

    [SSNI-631]A Female Boss With Big Tits And Her Employee Of The Month Go On A Business Trip Together And Spend The Entire Time Having Adulterous Sex - Saki Okuda

  • saki okuda censoredbig titsmarried womanSSNIs one number one stylebungo maedas1 no 1 styleSSNI-631SSNI631ssni00631
    • 2019-11-30
    120 min

    [SSNI-641]Extremely Small Micro Bikini - She Covers Herself In Lotion And Plays With You Nice And Close - Ema Shiiba

  • emma shiiba censoredslutSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-641SSNI641ssni00641
    • 2019-11-30
    120 min

    [SSNI-632]Her Pussy Twitches With Excitement When She Gets Fucked Hard And Fast! - Miharu Usa

  • miharu hanasaki censoredbig titsSSNIs one number one stylegoemons1 no 1 styleSSNI-632SSNI632ssni00632
    • 2019-11-30
    120 min

    [SSNI-636]My Stepsister Has Blossomed And Grown Some Huge Tits, So When I Went Home For The Weekend, I Secretly Fucked Her The Entire Time - Rika Aimi

  • rumi tadami censoredbig titsschoolgirlSSNIs one number one stylekitorune kawaguchis1 no 1 styleSSNI-636SSNI636ssni00636
    • 2019-11-30
    120 min

    [SSNI-633]When My Girlfriend Went Away On Business For 3 Days, I Fucked Her Younger Sister Every Day From Morning Until Night - Miru Sakamichi

  • see the slope censoredbeautiful girlsisterSSNIs one number one stylekitorune kawaguchis1 no 1 styleSSNI-633SSNI633ssni00633
    • 2019-11-30
    160 min

    [SSNI-634]A Beautiful Young Girl In A Sailor Uniform With Colossal Tits Gets Violated By Middle-Aged Maniacs - Shion Yuumi

  • evening beauty censoredbig titsuniformSSNIs one number one stylejo styles1 no 1 styleSSNI-634SSNI634ssni00634
    • 2019-11-14
    118 min

    [SSNI-622]This Man Is Tied Up And Unable To Move As This Healthy Slut With A Beautiful Body Keeps On Assaulting Him With A Smile As She Fully Controls His Ejaculations Nene Yoshitaka

  • nine yoshitaka censoredslutsingle workSSNIs one number one stylecrests1 no 1 styleSSNI-622SSNI622ssni00622
    • 2019-11-14
    119 min

    [SSNI-624]3 Years Ago My Lady Boss Retired To Get Married, But Now That She's Back, I Spent 3 Days At A Hotel During My Business Trip Fucking Her Brains Out, And Here's The Video Record To Prove It Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs one number one stylemeat respects1 no 1 styleSSNI-624SSNI624ssni00624
    • 2019-11-14
    152 min

    [SSNI-625]Welcome To The Super High Class J-Cup Sex Club Condo Enjoy A 150-Minute Full Course Of Jun Kakei's Hard And Tight Sensual Techniques

  • jun jun censoredbig titssingle workSSNIs one number one stylezampas1 no 1 styleSSNI-625SSNI625ssni00625
    • 2019-11-14
    120 min

    [SSNI-621]Her Legs Measure 88cm From Her Crotch To The Floor A Barely Legal Babe With Beautiful Legs The Temptation Of A High-Cut Uniform Arina Hashimoto

  • there is hashimoto censoredsquirtinguniformSSNIs one number one stylekyouseis1 no 1 styleSSNI-621SSNI621ssni00621
    • 2019-11-14
    118 min

    [SSNI-619]I Was Having Life-Destroying Orgasmic Sex With The Married Woman Next Door Tsukasa Aoi

  • tsukasa aoi censoredsingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-619SSNI619ssni00619
    • 2019-11-14
    119 min

    [SSNI-620]A Tiny Girlfriend With Light Skin And Big Tits Is Getting Stroked By Her Big Dick Friend In A Horse-Hung Straddling Fuck Fest For Cuckold Pleasure Palace Orgasmic Ecstasy Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs one number one styleasagiris1 no 1 styleSSNI-620SSNI620ssni00620
    • 2019-11-14
    210 min

    [SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-11-14
    120 min

    [SSNI-623]While My Girlfriend Was Away, I Spent 3 Days Fucking The Shit Out Of My Girlfriend's Best Friend, An Adult Video Actress Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSNIs one number one styleasagiris1 no 1 styleSSNI-623SSNI623ssni00623
    • 2019-11-02
    150 min

    [SSNI-613]Mixed Body Fluids, Deep Sex A Totally Uncut Special Mao Mashiro

  • pure white censoredbig titssingle workSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-613SSNI613ssni00613
    • 2019-11-02
    120 min

    [SSNI-611]Sensual Stimulation With Cum Facial Aphrodisiac Lotion! She's Awakening Her Ultra Sensual Full Body Erogenous Zone! A New Encounter With Slick And Slippery Orgasmic Sex Rika Aimi

  • rumi tadami censoredbig titssingle workSSNIs one number one stylesugawaras1 no 1 styleSSNI-611SSNI611ssni00611
    • 2019-11-02
    120 min

    [SSNI-616]A 175cm Tall Woman Climbs On Top Of You And Dominates You - She Spreads Your Legs And Rides You Cowgirl Style - Ema Shiiba

  • emma shiiba censoredSSNIs one number one styletake ds1 no 1 styleSSNI-616SSNI616ssni00616
    • 2019-11-02
    150 min

    [SSNI-612]A Beautiful Young Girl And A Middle-Aged Man Engage In Extreme, Vulgar Tongue-Kissing And Sex - Nodoka Sakuraba

  • sakuraha nodoka censoredbig titsblowjobSSNIs one number one styleusapyons1 no 1 styleSSNI-612SSNI612ssni00612
    • 2019-11-02
    120 min

    [SSNI-615]An 18-Year Old Diamond-In-The-Rough A Beautiful Girl Rin Kira Super Orgasmic Cumming! Her First Squirting! Her First Experiences A 3-Fuck Special

  • kira ri censoredsquirtingbeautiful girlSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-615SSNI615ssni00615
    • 2019-11-02
    120 min

    [SSNI-608]She Experiences Ultimate Pleasure, Getting Fucked Aggressively Until She Squirts Huge Loads Of Pussy Juice - Miru Sakamichi

  • see the slope censoredsquirtingbeautiful girlSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-608SSNI608ssni00608
    • 2019-11-02
    159 min

    [SSNI-614]124 Furious Orgasms! 4560 Spasms! 8700 cc Of Cum Fluid! A 19-Year Old Totally Beautiful Girl An Eros Company Awakening Her First Ultra Spasmic Special Riko Shiraha

  • riko shirahaba censoredsquirtingsingle workSSNIs one number one styledragon nishikawas1 no 1 styleSSNI-614SSNI614ssni00614
    • 2019-10-12
    120 min

    [SSNI-597]Climax G-Spot Development: Giant x Back Of Vagina Pressure Climax Orgasm - Mako Iga

  • iga mako censoredbeautiful girlSSNIs one number one styleusapyons1 no 1 styleSSNI-597SSNI597ssni00597
    • 2019-09-14
    479 min

    [OFJE-214]Moe Amatsuka Her 5th Anniversary Since Her Debut Best Hits Collection Her Newest 12 Titles 8-Hour Special

  • angel moe censoredschoolgirlbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-214OFJE214ofje00214
    • 2019-09-14
    118 min

    [SSNI-574]This J-Cup Titty Elder Sister (Fully Clothed) Will Always Be Luring You To Temptation With Her See-Through Bras Jun Kakei

  • jun ju censoredbig titsbeautiful girlSSNIs one number one stylekyouseis1 no 1 styleSSNI-574SSNI574ssni00574
    • 2019-09-05
    130 min

    [SSNI-558]I Fucked A Couple Of Sisters With Big Tits For Three Days Straight While Their Parents Were Out Of Town

  • evening beauty miharu hanasaki censoredbig titsuniformSSNIs one number one styleasagiris1 no 1 styleSSNI-558SSNI558ssni00558
    • 2019-08-16
    119 min

    [SSNI-543]My Teacher Saved Me From Being Bullied, But When She Was Getting Fucked By Some Bad Boys, I Watched Her And Jacked Off. The Thrill Of Watching Someone You Love Being Shamed And Humiliated! A New Kind Of NTR!! Nami Hoshino

  • nami hoshino censoredbig titsSSNIs one number one stylezach arais1 no 1 styleSSNI-543SSNI543ssni00543
    • 2019-07-13
    154 min

    [SSNI-523]My Girlfriend's Big Sister Seduced Me With Her Beautiful Legs And Panty Shots And I Couldn't Resist The Temptation. Ichika Hoshimiya

  • ichika hoshimiya censoredblowjobhandjobSSNIs one number one stylegoemons1 no 1 styleSSNI-523SSNI523ssni00523
    • 2019-07-13
    479 min

    [OFJE-206]Miharu Usa The 3rd Anniversary Of Her S1 Debut Commemorative Best Hits All New 10 Titles, 48 Episodes 480-Minute Special

  • miharu hanasaki censoredbig titsbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-206OFJE206ofje00206
    • 2019-07-13
    118 min

    [SSNI-522]I'm So Attracted To The Man I Hate The Most... Yura Kano

  • yura kanno censoredbeautiful girldramaSSNIs one number one styleasagiris1 no 1 styleSSNI-522SSNI522ssni00522
    • 2019-07-04
    164 min

    [SSNI-512]Defenseless Big Tits Beautiful Girl Who Moved In Next Door And Shut-in Otaku's (Me) Lust. Hotaru Nogi

  • nogi firefly censoredbig titscosplaySSNIs one number one stylebungo maedas1 no 1 styleSSNI-512SSNI512ssni00512
    • 2019-07-04
    120 min

    [SSNI-508]Ecstatic Twitching Pussy Hard Banging Marathon Fuck Miharu Usa

  • miharu hanasaki censoredbig titssquirtingSSNIs one number one stylesugawaras1 no 1 styleSSNI-508SSNI508ssni00508
    • 2019-06-15
    170 min

    [SSNI-498]S1 x MOODYZ Collab Nene Yoshitaka Lesbian Debut Passionate Climax Lesbian Fuck Full Of Kisses Nene Yoshitaka Sora Shiina

  • nine yoshitaka shiina sky censoredlesbianbeautiful girlSSNIs one number one stylezach arais1 no 1 styleSSNI-498SSNI498ssni00498
    • 2019-05-04
    120 min

    [SSNI-467]嫁の連れ子のどストライクおっぱいがずぅ～っと全力誘惑してくる日常。 羽咲みはる

  • miharu hanasaki censoredSSNIs one number one stylehiroharu osakis1 no 1 styleSSNI-467SSNI467ssni00467
    • 2019-04-04
    148 min

    [SSNI-451]Amateur NO. 1 STYLE Jun Kakei Porn Debut

  • jun ju censoredbig titsbeautiful girlSSNIs one number one stylecrests1 no 1 styleSSNI-451SSNI451ssni00451
    • 2019-03-24
    57 min

    FC2PPV 1055084 “Rei vol.1” Number one sex appeal beauty! Beautiful ass in a model-class style! Climax rolled up to the master’s raw cheeks! Begging “Please sperm inside”! Creampie training to the back of the vagina!

  • amateur uncensoredfc2
    • 2019-02-16
    132 min

    [SSNI-410]Prison Rape - She Was Passed Around For Total Obedience Prison Gang Bang Rape - "Please, Let Me Go..." She Was Put Away Behind Bars And Now She Was In A Sex Slave Prison From Which There Was No Escape... Nami Hoshino

  • nami hoshino censoredbig titsSSNIs one number one stylemeats1 no 1 styleSSNI-410SSNI410ssni00410
    • 2019-02-16
    147 min

    [SSNI-415]Drenched In Sweat And Saliva. Licking And Sucking Each Other All Over. Releasing All Their Body Fluids. Yura Kano

  • yura kanno censoredbeautiful girlSSNIs one number one stylecrests1 no 1 styleSSNI-415SSNI415ssni00415
    • 2019-02-16
    169 min

    [SSNI-416]I Will Wholeheartedly Molest Middle-Aged Men My Favorite Kind Of Men. Ichika Hoshimiya

  • ichika hoshimiya censoredsluthandjobSSNIs one number one stylenanzaki masakis1 no 1 styleSSNI-416SSNI416ssni00416
    • 2018-12-29
    479 min

    [OFJE-180]Saki Okuda's S1 Debut 5th Anniversary: A Massive 8 Hour, 12 Title, 53 Corner Best Hits Compilation

  • saki okuda censoredbig titsmarried womanOFJEs one number one styles1 no 1 styleOFJE-180OFJE180ofje00180
    • 2018-12-13
    146 min

    [SSNI-368]Targeted By A School Swimsuit Enthusiast... Aika Yumeno A Tenacious Stalker Secretly Films A Girl In Uniform And Violates Her Privacy

  • yumeno aika censoredbig titsschoolgirlSSNIs one number one stylemeats1 no 1 styleSSNI-368SSNI368ssni00368
    • 2018-11-17
    131 min

    [SSNI-352]1-Year Anniversary! Her First Bukake, Shaved Pussy And Orgy! Poke Her Trembling Shaved Pussy As She Orgasms With 20 Dicks. Relentless Fucking. Huge Orgy. Special Featuring 20 Sex Scenes. Yura Kano

  • yura kanno censoredbeautiful girlbukkakeSSNIs one number one stylexs1 no 1 styleSSNI-352SSNI352ssni00352
    • 2018-11-17
    119 min

    [SSNI-350]Hanon Hinana Is Completely Restrained And Unable To Move. Endless Fucking That Doesn't Stop No Matter How Many Times She Orgasms

  • hinana is no censoredsquirtingSSNIs one number one stylesugawaras1 no 1 styleSSNI-350SSNI350ssni00350
    • 2018-11-17
    151 min

    [SSNI-354]A Classy Girl With A Beautiful Fair-Skinned Body. Here Cums Ichika Hoshimiya. Special Featuring Her First 3 Sex Scenes

  • ichika hoshimiya censoredSSNIs one number one styleusapyons1 no 1 styleSSNI-354SSNI354ssni00354
    • 2018-11-17
    168 min

    [SSNI-346]Sickening Video Of How My Girlfriend Was Fucking Other Men From Dusk To Dawn During The 2 Days I Was Away. Tsukasa Aoi

  • tsukasa aoi censoredbig titsbeautiful girlSSNIs one number one stylexs1 no 1 styleSSNI-346SSNI346ssni00346
    • 2018-11-17
    151 min

    [SSNI-353]193 Intense Orgasms! 4700 Trembles! 10,000ml Of Squirt! The 18-Year-Old With A Knack For Sex. Awakening Eros. Big, Trembling Special. Miru Sakamichi

  • see the slope censoredsquirtingbeautiful girlSSNIs one number one styleusapyons1 no 1 styleSSNI-353SSNI353ssni00353
    • 2018-10-18
    119 min

    [SSNI-323]You Can Get A Quickie Fuck Anytime Here A Pantyless Cafe Where You're Guaranteed To Get A Fuck Nami Hoshino When She Flips That Skirt, Underneath Is Her Peachy, Tight Ass There's No Way You Can Go Home Without Getting Some (Cock Ins

  • nami hoshino censoredSSNIs one number one stylezampas1 no 1 styleSSNI-323SSNI323ssni00323
    • 2018-10-06
    719 min

    [OFJE-168]Best Of Hanon Hinana . Celebrating 1 Year Since Her S1 Debut. All 13 Titles. 12-Hour Special

  • hinana is no censoredsquirtingOFJEs one number one styles1 no 1 styleOFJE-168OFJE168ofje00168
    • 2018-09-15
    154 min

    [SSNI-301]Yua Mikami Is Completely Tied Down And Unable To Move Unlimited Piston Pounding Fucks That Won't Stop No Matter How Many Times She Cums Until Her Hips Shake So Much That They're About To Shatter

  • yua mikami censoredbig titsSSNIs one number one stylekyouseis1 no 1 styleSSNI-301SSNI301ssni00301



    • Jav Movie Free Download