other fetish javcensored high vision beautiful girl slender




FC2ROYDGVHNNPJAVSASDABGMEMMIDESSNIVENXWANZKBISPRDAPODMARAATIDSQTEFSDSSPPPDSSISVEMA

2021-11-19
119 min

[MBDD-2063]Rin Natsuki / As Rin

  • rin natsuki censoredbeautiful girlsingle workMBDDmedia brandMBDD-2063MBDD2063301mbdd02063
    • 2021-10-15
    83 min

    [LBDD-005]Mahiro Ichiki A Pure And Pretty Beautiful Girl With Black Hair

  • mahiro ichiki censoredbeautiful girlsingle workLBDDmedia artsLBDD-005LBDD005162lbdd00005
    • 2021-09-17
    96 min

    [LBDD-004]Kanon Kawase/The Innocent Brilliance OF THis Black Haired Beautiful Girl

  • kanon kawase censoredbeautiful girlsingle workLBDDmedia brandLBDD-004LBDD004162lbdd00004
    • 2021-09-03
    148 min

    [JUFE-323]This Shut-In College Girl Is Getting Her Slender, Beautiful, Big Tits Body Pounded Like Crazy! E-Cup Titties, With 3 Juicy, Spasmic, Orgasmic Fucks Special Yuria Hakaze

  • yuria hafu censoredbig titssingle workJUFEfitchJUFE-323JUFE323jufe00323
    • 2021-06-18
    89 min

    [MBDD-2056]Haruka Morimoto/Secret Love

  • haruka morimoto censoredbeautiful girlsingle workMBDDmedia brandMBDD-2056MBDD2056301mbdd02056
    • 2020-10-17
    122 min

    [SSNI-898]My Stepsister's Been Tempting Me With Her Panty Shots For The Past Three Years, So I Finally Crossed The Line. Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsisterSSNIs1 no 1 stylejo asagiriSSNI-898SSNI898ssni00898
    • 2020-09-10
    123 min

    [FSDSS-092]Heavenly Cowgirl - You Just Lay There Okay？ Low Sex SK**ls？ Let Her Divine Hip Humping Technique Take You To Heaven Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workFSDSSfalenowild sevenfaleno starFSDSS-092FSDSS0921fsdss00092
    • 2020-08-30
    261 min

    [GAV-048]That's An Ass!!

  • censoredamateurbeautiful girlGAVgogo adult videosGAV-048GAV048gav00048
    • 2020-05-11
    53 min

    [EMOI-006]An Emotional Girl/Her 4th Video/Let's Lead A Fresh Face To Ecstasy/Rotating Bed/A Showa Love Hotel/A Couple, Born In The Heisei Era/Emi Suzukaze (23)

  • emi suzukaze censoredbeautiful girlsingle workEMOIsod createtiger kosakaiemotional girlEMOI-006EMOI0061emoi00006
    • 2020-04-25
    150 min

    [MIFD-112]Working For The Knee High Socks Project Planning And Development Department Of A Famous Apparel Company! This Newly Graduated, Tall Girl Landed A Provisional Offer By Showing Off Her Total Domain, And Now Makes Her AV Debut Haruka

  • haruka censoredbeautiful girlsingle workMIFDmoodyzmon cmoodyz freshMIFD-112MIFD112mifd00112
    • 2019-11-22
    121 min

    [XRW-784]The Stepdaughter She Was Fucked By A Panythose-Loving Father-In-Law And Her Crazy Big Brother-In-Law Kotone Toa

  • toua kotone censoredcreampiebeautiful girlXRWreal workshideki hormonreal real worksXRW-784XRW784172xrw00784
    • 2019-11-17
    163 min

    [DASD-604]But You Said If You Played With My Nipples That My Titties Would Grow Bigger Hina Ayame

  • haruna ayame censoredbeautiful girlsingle workDASDdasgoemonDASD-604DASD604dasd00604
    • 2019-07-11
    169 min

    [FSET-838]A Beautiful Shop Girl Who Keeps On Working Without Realizing That She's Been Flashing Nip Slips

  • rio okita hikaru konno censoreddramaFSETakinoriboutarouaknrFSET-838FSET8381fset00838
    • 2019-03-22
    121 min

    [DASD-512]My Slender Childhood Friend Tempted Me With Her Big Ass So I Prone-Boned Her And Impregnated Her. Mai Nanase

  • nanase mai censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-512DASD512dasd00512
    • 2019-01-27
    98 min

    [SKMS-003]The Sexy, Beautiful Legs Of A Tall Girl Around An Engorged Penis. Forcing Our Way Into The Home Of A Perverted Young Wife On A Walk And Fucking Her. Rin Hifumi

  • one thousand three bells censoredsingle workSKMSmercurysukima industriesSKMS-003SKMS003h-1133skms00003
    • 2018-11-10
    152 min

    [IPX-231]The Peachy Ass And Creampie Temptation Of My Big Sister Who Adores Me. Yume Nishimiya

  • yume nishinomiya censoredbeautiful girlsisterIPXidea pocketxavier thomasdishIPX-231IPX231ipx00231
    • 2018-10-26
    313 min

    [SABA-461]Encyclopedia Of Amateur Nudes ~Beautiful Teenage Girls

  • censoredamateurbeautiful girlSABAskyu shirotoSABA-461SABA461h-244saba00461
    • 2016-12-24
    119 min

    [SNIS-808]Blowjob, Penetration, Repeat: Sucking on Pussy-juice Soaked Dick (Riho Sasakawa)

  • riho ayukawa censoredbeautiful girlsingle workSNISs1 no 1 styleoosaki hirokoujiSNIS-808SNIS808snis00808
    • 2016-12-17
    119 min

    [SNIS-803]Jerk Yourself Off With This Cosplay Princess A Slender Cosplayer In 6 Cosplay Transformation Sex Scenes Arina Hashimoto

  • there is hashimoto censoredcosplaybeautiful girlSNISs1 no 1 stylezampaSNIS-803SNIS803snis00803
    • 2016-09-03
    118 min

    [SNIS-729]See-Through Skimpies - Golden Body Cosplay Miku Akari

  • akari miki censoredbig titscosplaySNISs1 no 1 stylezampaSNIS-729SNIS729snis00729
    • 2015-10-29
    120 min

    [IPZ-644]Cram School Teacher in a Tight Skirt: A Dangerous Invitation from a Beauty with Shapely Legs Airi Kijima

  • airi kijima censoredbeautiful girlslutIPZidea pockettadanori usamidishIPZ-644IPZ644ipz00644
    • 2015-08-29
    147 min

    [IPZ-617]Cram School Teacher In A Tight Skirt - Michiru Morisaki

  • michiru morisaki censoredbeautiful girlsingle workIPZidea pocketk c takedadishIPZ-617IPZ617ipz00617
    • 2015-03-24
    130 min

    [OMEG-006]w30! An Innocent Girl's Amazingly Divine Waist. She Uses Her Seductive Magic To Enchant Men Into Another Dimension! Maya Kawamura (20)

  • kawamura maya censoredsingle workOMEGzettonzetton zettonOMEG-006OMEG006118omeg00006
    • 2014-05-29
    152 min

    [MIAD-684]Suntan marks Misuzu

  • censoredbig titsbeautiful girlMIADmoodyzmoodyz acidMIAD-684MIAD684miad00684
    • 2014-05-03
    479 min

    [ONSD-805]Aika Yumeno - S1 Minimal Mosaic Eight Hour Best Collection

  • yumeno aika censoredbig titsbeautiful girlONSDs1 no 1 styleONSD-805ONSD805onsd00805
    • 2013-10-01
    119 min

    [WANZ-102]Real College Girl Kanako Beautiful Girl With A Slutty Wet Pussy

  • censoredamateurbeautiful girlWANZwanz factorywanzWANZ-102WANZ1023wanz00102
    • 2013-05-30
    117 min

    [MIDD-971]Feeling Lips and Tongue, Sensational French Kiss ( Miku Ohashi )

  • ohashi miku censoredbeautiful girlsingle workMIDDmoodyzcobamoodyz divaMIDD-971MIDD971midd00971
    • 2013-02-07
    118 min

    [EBOD-260]Choosing a Woman's Body By Her Slender Curve. Mikuni Maisaki

  • mikuni maisaki censoredbig titsbeautiful girlEBODe bodyhao minamiEBOD-260EBOD260ebod00260
    • 2012-05-11
    118 min

    [MIAD-557]After Suntan Rina

  • censoredbeautiful girlMIADmoodyzmoodyz acidMIAD-557MIAD557miad00557



    • Jav Movie Free Download