muscular javcensored jav def slender




FC2SSISWAAABLKVENXMEYDSQTEDASDSPRDMIDEMARANACRGVHHUNTBCAWDATIDMIDVAVSASTARSAUKSSDAB

2024-05-03
120 min

WAAA-376 Sex Muscle Bakibaki Elegant Athlete With Full Power Standing Back Knee Gaku Tide Bubble Sagi Squid Sexual Fucking Lunar

  • tsuzuki ruisa censoredcreampiesquirtingWAAAones factorywanzWAAA-376WAAA376waaa00376
    • 2024-02-21
    144 min

    XOX-009 Office Lady By Day, Pole Dancer By Night, Beautiful Muscular Body, Newcomer Miina Yukisaki, 29 Years Old, Raw Creampie AV Debut

  • yukisaki miina censoredXOXhmn worksgold rachanew starXOX-009XOX009h-1472xox00009
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2023-11-17
    94 min

    ERHV-028 Sexually Uninhibited Returnee Girl, Sexy Private Sex Video Of Overseas Training Leaked. Big Nipples And Muscular Slender Erotic Body Bend Over And Cum! !

  • censoredcreampieblowjobERHVhmn workslove girlfriendERHV-028ERHV028h-1472erhv00028
    • 2023-04-06
    81 min

    ERGV-056 A Dancer Who Looks Like A Raccoon Dog Was Poked In The Womb By A Tall Man And Got Her Female Face Creampied And Creampied Sex! Muscular, Slender, Beautiful Body, Shaking And Squeaking!

  • censoredcreampieamateurERGVhamedori.network secondeditionlove girlfriendERGV-056ERGV056h-1472ergv00056
    • 2019-11-30
    150 min

    [PRED-202]A Wholesome Female Anchor Awakens Her Inner Slut - "Keep On Fucking Me Even After You've Cum!" - Ravenous Sex With An Athletic Body - Yuki Takeuchi

  • yuki takeuchi censoredsquirtingslutPREDpremiumhiroharu osakielegancePRED-202PRED202pred00202
    • 2018-08-23
    120 min

    [KTRA-050]Muscular Beautiful Girl Runner Kaori Kino

  • kaori kino censoredsquirtingamateurKTRAk tribeKTRA-050KTRA050h-094ktra00050
    • 2018-07-14
    118 min

    [SSNI-263]Flesh Fantasy Twitching And Trembling Sex With An Exquisitely Beautiful And Muscular Body, Honed And Trained Through Sex Toka Rinne

  • roaring sound censoredbig titssquirtingSSNIs one number one stylecrests1 no 1 styleSSNI-263SSNI263ssni00263
    • 2018-07-07
    119 min

    [EBOD-646]Boyish College Girl With An Exceptionally Thin Yet Muscular Body Making Her E-Body Exclusive Debut Rei Sasaki

  • rei sasaki censoredbig titsEBODe bodyEBOD-646EBOD646ebod00646



    • Jav Movie Free Download