javcensored censored hours more high vision schoolgirl

FC2NACRVENUJULAMBIVENXONEZCESDSSISMARASANSQTEAVSAADNMILKHNDMIAAGMEMWAAAVEMAHMN

2019-07-04
239 min

[HUNTA-619]"Please Don't Move... Your Dick Will Go Inside Me...!" I Spent A Week With My Little Sister-In-Law Engaging In A Pull Out Pussy Grind Sex Life, And I Finally Could No Longer Resist, So I Plunged My Cock Into Her! When I Entered

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-619HUNTA619hunta00619
    • 2019-06-28
    479 min

    [OKAX-524]If You Have Real Sex At This Pink Salon, The Penalty Is 1 Million Yen, But It's So Amazing You've Gotta Try It!!

  • censoredcreampieschoolgirlOKAXk m produceokazuOKAX-524OKAX52484okax00524
    • 2019-06-21
    241 min

    [SIM-038]I Was Having Amazing Sex With This Modern Sch**lgirl When She Got On The Phone And Introduced Me To Her Friend!？ My Network Of Cute And Sexy Friends Is Getting Bigger And Bigger!! Creampie Raw Footage Of Sex With Everybody

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-038SIM038118sim00038
    • 2019-06-20
    250 min

    [SDMM-022]The Magic Mirror. [Female Student Only] Her First Tied-Up, Sex Toy Experience! 10 Neat And Clean Girls Play The "Counting Down 3 Minutes Game" While We Press An Electric Massagers Against Their Crotches And Insert A Vibrators Inside

  • censoredschoolgirlSDMMsod createanzomagic mirrorSDMM-022SDMM0221sdmm00022
    • 2019-06-16
    240 min

    [DVDMS-409]The Magic Mirror Number Bus, Faces Revealed! Sch**lgirls Only This Amateur Sch**lgirl Is Getting Her First Big Dick Ekiben Sex Experience! This Tiny J* Is Getting Lifted Up And Put Into A Position Of Shame And Pumped And Thrusted Over And

  • censoredcreampieschoolgirlDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-409DVDMS409dvdms00409
    • 2019-06-15
    290 min

    [HUNTA-612]9 Girls Get Their Nipples Twisted And Turned On During A Physical Exam! Vol.2. With The Help Of A Doctor I Know, I Went Undercover As An Assistant At A Physical Examination For Barely Legal Girls! I Freely Touch Their Bodies, Twist Their N

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-612HUNTA612hunta00612
    • 2019-06-14
    280 min

    [MDTM-527]Black-haired Honor Student and Old Lecherous Man - 4 Hours of Shameful Sex

  • have ishihara rurica censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-527MDTM52761mdtm00527
    • 2019-06-01
    236 min

    [HUNTA-609]"I'm Sorry... I Was So Lonely, That I Just Had To Cum Over..." My Childhood Friend Had Moved Far Away, But Suddenly She Showed Up At My House! And Unlucky For Her, She Got Caught In A Sudden Rainstorm, And Was Soaking Wet, And

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-609HUNTA609hunta00609
    • 2019-06-01
    236 min

    [HUNTA-607]Thanks To My Little Sister-In-Law, I'm Getting Sex Every Day. When Their Parents Got Remarried, This Shut-In Big Brother-In-Law Turned Into A Sexual Monster After They Started Living Together! 2 Every Day, He's Enjoying Masturbatio

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-607HUNTA607hunta00607
    • 2019-06-01
    342 min

    [HUNTA-606]"Hey Big Brother, Are You Ignoring Me？" "No Dummy, I'm Doing The Exact Opposite! You're Just My Type (*That's What My Heart Is Saying)!" 2 My Little Step Sister Is Innocently Getting Up Close And Personal With

  • censoredschoolgirlsisterHUNTAhuntervolvo nakanohhh groupHUNTA-606HUNTA606hunta00606
    • 2019-05-31
    261 min

    [OKAX-518]Are You Serious!？ This Popular Beautiful Girl At School Is Working Part-Time At This Super Shady Underground Sex Club! 4 Hours

  • sena mao kotoki kaoru censoredcreampieschoolgirlOKAXk m produceokazuOKAX-518OKAX51884okax00518
    • 2019-05-23
    285 min

    [PIYO-030]A Young Girl Has 6 Holes, And They All Feel Nice And Good. This Dirty Old Man's Cock Is Going In And Out Of These Barely Legal Babes' Mouths, Pussies, And Anal Holes. Enjoy Chapter 2.

  • censoredschoolgirldeepthroatPIYOhyokopiero dagrey wolfPIYO-030PIYO0301piyo00030
    • 2019-05-17
    300 min

    [DVDMS-399]Faces Revealed!! The Magic Mirror Number Bus 3 Minutes Ago, She Was Still A Sch**lgirl! We're Breaking All The Rules And Picking Up Girls Right After Their Graduation!! A 10-Girl Sex Special!! This School Has Historically Been Requeste

  • censoredschoolgirlamateurDVDMSdeep sjohan yuanthe magic mirrorDVDMS-399DVDMS399dvdms00399
    • 2019-05-16
    240 min

    [HUNTA-603]He Committed Infidelity, So I'm Committing Infidelity Too! She Never Let Him Fuck Her Raw, But Now She's Cumming On To Me! My Friend And His Girlfriend Are Always Hanging Out With Me In My Room. When They Show Off How Happy They Ar

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-603HUNTA603hunta00603
    • 2019-05-04
    445 min

    [HUNTA-594]5 Brand New Titles Featurin Serious Schoolgirls. 8 Girls. Special Edition! A Serious But Slutty Girl With A Student Who Refuses To Go To School... +"I'll Have Sex With You If You'll Come To School..." + With Unconscious Nip

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-594HUNTA594hunta00594
    • 2019-05-04
    239 min

    [HUNTA-593]"If You Can Keep It A Secret, We Can Do Something Naughty" My Super Cute, Neat And Clean Stepsister Orgasms Like A Slut When I Touch Her Pussy! Our Parents Remarried And My New Stepsister Is Super Cute! She's A Nice Girl Who Lo

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-593HUNTA593hunta00593
    • 2019-04-13
    240 min

    [HUNTA-584]My Stepsister Has A Super Beautiful Ass And Her Ass Cheeks Peek Out From The Bottom Of Her Hot Pants! My New Younger Stepsister Has A Beautiful, Sexy Ass!! Pantyshot Under The Skirt Of Her Uniform! Her Loungewear Shorts! But Above All, Her

  • censoredschoolgirlsisterHUNTAhunterkawajirihhh groupHUNTA-584HUNTA584hunta00584
    • 2019-04-13
    405 min

    [HUNTA-581]"I Don't Have Much Experience But You Can Use Me To Practice Sex... You Can Mess Up As Many Times As You Want..." Sex Practice With A Kind Classmate! Recently Everyone At School Found Out That I'm A Cherry Boy And Now I Get

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-581HUNTA581hunta00581
    • 2019-04-13
    458 min

    [AP-652]Super Selections! New Year's Exclusive Footage! Molester Appreciation Fair No.3 15 "Sch**lgirl" Victims Special!

  • censoredschoolgirlAPapachekuniokahhh groupAP-652AP652ap00652
    • 2019-04-04
    330 min

    [HUNTA-575]"No! Your Dick Is Inside My Pussy!! Please Stop!!" I Was Pussy Grinding With My Excessively Cute, Secretly Horny Childhood Friend, When My Dick Just Slipped Inside! It Felt So Good That I Kept It In There For Some Creampie Raw Foot

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-575HUNTA575hunta00575
    • 2019-04-04
    457 min

    [HUNTA-578]A Childhood Friend Variety Project A 3-Video Special (Practice Sex With My Slutty Childhood Friend & My Childhood Friend Is Dating This Shitty Asshole That I Know! And This Shitty Asshole Is Showing Off How Sexy My Childhood Friend Look

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-578HUNTA578hunta00578
    • 2019-04-04
    236 min

    [HUNTA-576]I Was Super Angry, So I Shoved My Rock Hard Cock Into My Little Stepsisters Mouth, And To My Surprise, Things Turned Out To Be Divine!! I Got A New Little Stepsister-In-Law, And She's Super Cute! But She's Got A Super Bad Personali

  • censoredschoolgirlblowjobHUNTAhunterkawajirihhh groupHUNTA-576HUNTA576hunta00576
    • 2019-04-01
    271 min

    [DOKS-479]Filthy Medical Examinations By A Perverted Doctor Who Relentlessly Palpates The Nipples Of Girls In Uniform! Schoolgirl Nipple Examination Collection. 4 Hours And 30 Minutes

  • south star love mari rika censoredbig titsuniformDOKSoffice k sDOKS-479DOKS47936doks00479
    • 2019-03-31
    244 min

    [KTKY-036]"We Live In The Country, And There's Nothing To Do Out Here But Fuck!" Nationwide Barely Legal Girls Pictorial 4 Hours

  • censoredcreampieschoolgirlKTKYkitixx mousouzokuKTKY-036KTKY036ktky00036
    • 2019-03-29
    243 min

    [SIM-031]I Got Super Excited For A Sch**lgirl In Knee-High Socks And The Total Domain Of Her Hot Thighs...

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-031SIM031118sim00031
    • 2019-03-22
    227 min

    [MDTM-500]Girls In Uniform Are Deceived And Fucked By Older Men. 4 Hours

  • censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-500MDTM50061mdtm00500
    • 2019-03-22
    241 min

    [XRW-659]Thick Big Tits Girl Carnal Training 4 Hours

  • serizawa ruru itsuki maino censoredcreampiebig titsXRWreal worksreal real worksXRW-659XRW659172xrw00659
    • 2019-03-22
    241 min

    [SIM-029]A JK Braless Stroll!! When This Remote Vibrator Gets Turned Onn, Her Nipples Are Rock Hard And Erect! Will She Seriously And Bashfully Cum In Public!？ 2

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-029SIM029118sim00029
    • 2019-03-22
    252 min

    [SKMJ-036]Picking Up Girls In Order Of Cuteness In Their Graduation Album

  • censoredcreampieschoolgirlSKMJred face girlyuseiSKMJ-036SKMJ036h-1324skmj00036
    • 2019-03-21
    242 min

    [SDAM-012]"Give Me Cum In My Pussy" 6 Ovulation Creampies For A Girl Who Asks To Be Creampied An Hour After Her Graduation

  • censoredcreampieschoolgirlSDAMsod createanzoSDAM-012SDAM0121sdam00012
    • 2019-03-17
    240 min

    [TKTK-003]I Love Schoolgirl Stars 4 Hours

  • censoredschoolgirlamateurTKTKjewelry box daydream familyjewelry boxTKTK-003TKTK003tktk00003
    • 2019-03-16
    319 min

    [HUNTA-571]"I Can Give You A Blowjob" My Slightly Loose Classmate May Look Like A Slut, But... A Female Classmate Came To My House To Read Manga While Waiting For Someone. She Really Didn't See Me As A Real Man And Thought I Didn't Ha

  • censoredschoolgirlblowjobHUNTAhunterkawajirihhh groupHUNTA-571HUNTA571hunta00571
    • 2019-03-10
    241 min

    [HEZ-019]Girls In School Uniforms Are This Naughty!？ Girls Who Look Innocent But Are Addicted To Sex. 14 Girls, 4 Hours

  • censoreduniformschoolgirlHEZhot entertainmentHEZ-019HEZ01959hez00019
    • 2019-03-07
    245 min

    [SDMM-010]Schoolgirls Kiss For The First Time While Trying Out A New Lip Balm! The Grown-Up Kisses Make Their Cute, Innocent Pussies Dripping Wet So We Gave Them Big Dicks And Bitter Cum! The Magic Mirror

  • censoredschoolgirlamateurSDMMsod createmohikarumagic mirrorSDMM-010SDMM0101sdmm00010
    • 2019-03-07
    238 min

    [IENE-983]Amateur Schoolgirls. If You Have Intercrural Sex Over Plastic Wrap With Your Brother And Make Him Cum, You'll Win A Cash Prize!!

  • censoredschoolgirlamateurIENEienergykikurinie nergyIENE-983IENE9831iene00983
    • 2019-03-06
    239 min

    [HUNTA-561]"Hey, Big Brother. You're The Only One Who Praises My Titties." "You're The Only One Who Says Nice Things About My Cock..." A Colossal Tits Little Sister-In-Law Who Is Self-Conscious About Her Excessively Huge Tits

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-561HUNTA561hunta00561
    • 2019-03-06
    320 min

    [HUNTA-559]I'm At A Share House Filled With Runaway Barely Legal Babes, And I'm The Only Guy!？ I Inherited A House In The City. But Since There Were Too Many Empty Rooms, I Put Out An Ad For Tenants, And A Runaway Barely Legal Came. I Didn�

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-559HUNTA559hunta00559
    • 2019-03-06
    236 min

    [TSP-416]Leaked By A TV Producer! Some Of The Victims Were Virgins？! He Took Home Schoolgirls From His Show! Toro Toro Kiss With An Aphrodisiac Lozenge Makes The Girls Go Weak! He Then Secretly Films The Creampie Sex

  • censoredcreampieschoolgirlTSPtokyo specialTSP-416TSP416tsp00416
    • 2019-03-01
    237 min

    [BUR-523]Lo**** Highlights 4 Hours 6

  • censoredcreampieschoolgirlBURglay zburst graceBUR-523BUR52312bur00523
    • 2019-02-22
    240 min

    [OKAX-479]I Can Never Tell My Parents... The Truth Is, I'm Being Raped Every Day After School 2

  • censoredcreampieschoolgirlOKAXk m produceokazuOKAX-479OKAX47984okax00479
    • 2019-02-22
    240 min

    [OKAX-477]A Must-See For Panty Shot Enthusiasts! A Massage Parlor Where The Girls Unintentionally Provoke You With Panty Shots. 4 Hours

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-477OKAX47784okax00477
    • 2019-02-22
    239 min

    [BAZX-175]A Modern Cute Gal Schoolgirl vol. 006

  • censoredcreampieamateurBAZXmedia stationtodobazookaBAZX-175BAZX17561bazx00175
    • 2019-02-21
    279 min

    [SDMM-008][Schoolgirls Only] The Magic Mirror Number Bus She Was Told That She Would Be Participating In "An Underwear Manufacturer Testing Study" But She Was Given A Tit Fondling Interview She Looks Naive And Innocent, But She Says Some Unbe

  • censoredschoolgirlSDMMsod createanzomagic mirrorSDMM-008SDMM0081sdmm00008
    • 2019-02-16
    240 min

    [HUNTA-553]"Hey Uncle, Can I Give You A Blowjob？" "What! I Want To Suck His Dick Too!" "Hey, No Fair! Me Too!" My 6 Nieces Are At My House In My Bathtub, Fighting Over My Cock! My 6 Nieces Had Come Home For The First Time In

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-553HUNTA553hunta00553
    • 2019-02-16
    238 min

    [HUNTA-558]Completely Bewitched By My Little Sister's Ass!! My Boner Pushes Up Against Her Pussy Over Her Panties! "I Didn't Know Your Ass Was This Cute!？" My Sister And I Have Been Close Since We Were Kids And All This Time I Didn�

  • censoredschoolgirlsisterHUNTAhuntermorikihhh groupHUNTA-558HUNTA558hunta00558
    • 2019-02-08
    241 min

    [MDTM-486]Super Horny Girls from an Elite Girls School Show Us Their True Colors 05

  • censoredcreampieuniformMDTMmedia stationsuginokiuchu kikakuMDTM-486MDTM48661mdtm00486
    • 2019-02-01
    383 min

    [AVOP-408]A Game Of Truth Or Dare... And I'm The Only Guy!？ "Staying After School To Help With The School Festival" Edition I Stayed In The Classroom After School To Help Get Ready For The School Festival When I Was Forced Into A Game Of

  • censoredschoolgirlAVOPhunterkawajiriav open 2018AVOP-408AVOP408avop00408
    • 2019-01-25
    247 min

    [SKMJ-022]My Childhood Friend Gave Me A Serious Cherry Boy Graduation! These 4 Cherry Boy Losers Were In Love With Girls But Could Never Tell Them How They Felt, And So They're Going To Their Childhood Friends To Consult Them About Love! Can They

  • censoredcreampieschoolgirlSKMJred face girlyuseiSKMJ-022SKMJ022h-1324skmj00022
    • 2019-01-24
    304 min

    [PIYO-019][Total Amateur Participation Type] A Sweet Trap For Young Girls Lovey Dovey Sweet But Occasionally Devilish - 6 Lovingly Exquisite Surprise Punked Specials! A 4 Fucks/10 Ejaculation Special! *We Swear, This Is All For Real -

  • aoi kururugi censoredschoolgirlsingle workPIYOhyokopiero daamaenboPIYO-019PIYO0191piyo00019
    • 2019-01-24
    300 min

    [SVOMN-119]Collection Of Porn Featuring Schoolgirls Getting Raped Till They Orgasm. 55 Victims, 5 Hours

  • censoredsquirtingschoolgirlSVOMNsadistic villageSVOMN-119SVOMN1191svomn00119
    • 2019-01-24
    725 min

    [DANDY-646]100 Sch**lgirls Who Were Teased And Toyed With Rock Hard Cocks!! DANDY 13th Year Commemorative 12-Hour SPECIAL

  • censoredschoolgirlDANDYdandyDANDY-646DANDY6461dandy00646
    • 2019-01-17
    240 min

    [GDHH-136]"Take My Virginity, Right Here, Right Now!" My Barely Legal Little Sister Bragged To All Her Friends That She's A Total Slut, But She's Actually A Total Virgin! And Now That Her Secret's About To Come Out, She Begs Me, H

  • censoredschoolgirlsisterGDHHgolden timerobby kunhhh groupGDHH-136GDHH136gdhh00136
    • 2018-12-29
    240 min

    [HUNTA-539]"I May Not Look It, But I'm Seriously Horny!" My Neat And Clean Beautiful Childhood Friend Is Drooling And Panting And Having Violent Orgasms And She Keeps On Begging For More!! During Elementary, Middle, And High School, My Ch

  • censoredschoolgirlbukkakeHUNTAhuntervolvo nakanohhh groupHUNTA-539HUNTA539hunta00539
    • 2018-12-28
    239 min

    [HFD-181]Daytime Sex With Beautiful, Young Girls In Uniform 15.4 Hours Of Fully Clothed Sex

  • aoi yuuki nagomi censoredschoolgirlblowjobHFDdream ticketHFD-181HFD18124hfd00181
    • 2018-12-28
    240 min

    [OKAX-454]A Boob Rubbing Massage Parlor Frequented By Tiny Titty Girls 4 Hours

  • censoredschoolgirlbeautiful girlOKAXk m producedick mandokuokazuOKAX-454OKAX45484okax00454
    • 2018-12-28
    487 min

    [CDC-004]40 Beautiful Ladies With Divine Big Tits Are Cumming Down Upon Us! Pregnancy Fetish Creampie Sex 8 Hours

  • censoredcreampiebig titsCDCprestigecross docCDC-004CDC004118cdc00004
    • 2018-12-28
    231 min

    [MDTM-463]This Schoolgirl Leaves After School Early To Go To A Creampie Part-Time Job 4 Hours II

  • censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-463MDTM46361mdtm00463
    • 2018-12-28
    239 min

    [OKAX-457]I Can Never Tell My Parents... The Truth Is, I'm Being Raped Every Day After School

  • censoredcreampieschoolgirlOKAXk m produceokazuOKAX-457OKAX45784okax00457
    • 2018-12-27
    244 min

    [FNEO-006]Meeting Up With Someone In The Real World, Alone~ A Man And Woman Meet Offline 01. We Met Up At A Local Convenience Store. She Was Very Familiar And Kept Pressing Her Tits Against Me. She Willingly Followed Me Home. Runaway Girls Looking Fo

  • censoredcreampiebig titsFNEOfirst starfirst star neoFNEO-006FNEO006h-491fneo00006
    • 2018-12-20
    469 min

    [DANDY-640]DANDY's Assortment Of Select Work Edition Year-End Special

  • censoredschoolgirlnurseDANDYdandydandy yoshinoDANDY-640DANDY6401dandy00640



    • Jav Movie Free Download