jav upskirt javcensored schoolgirl knee socks




FC2SSISCHRVNATRPPPDVEMAVENXCESDHODVSSNIGVHSHKDMARAWAAASPRDSTARSEBODNNPJLULUDASDHDKA

2021-12-24
184 min

[HUNTB-171]Glasses x Knee-High Socks x Miniskirt x Thong This Sch**lgirl Is So Excessively Erotic, She"s Giving Me A Full-On Hard On! "I Don"t Know If I Can Make You Feel Good, But I Can Do Some Sexy Things For You ..."

  • censoredschoolgirlHUNTBhuntermorikihhh groupHUNTB-171HUNTB171huntb00171
    • 2021-11-25
    200 min

    [SW-813]C***dhood Friend With A Knee-high Stocking S********l Outfit Gives A Panty Shot, And I Got To See Her Thighs And Panties! She Has Liked Me For A Long Time It Seems, And Hearing Her Cutely Confess Her Feelings Got My Dick So Hard!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-813SW8131sw00813
    • 2020-02-28
    239 min

    [OKAX-596]Fucking Forbidden! Testing The Options At A Secret Sexual Massage In The City! CCD Peeping 240 Min

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-596OKAX59684okax00596
    • 2019-10-10
    186 min

    [SW-660]Every Morning, I See This Sch**lgirl Flashing Panty Shot Action At Me In Her Knee-High Socks And She Was So Cute That She Was Getting My Dick Hard And Then She Said, "You're Such A Pervert." And Then She Got Mad At Me. But Then He

  • kotone rui censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-660SW6601sw00660
    • 2019-10-03
    320 min

    [HUNTA-662]I'm Super Popular With Girls In Knee-High Socks x Miniskirt Outfits, And I'm Fucking The Shit Out Of Them Too!! I Enrolled Into A New School, Which Was An All Girls School Until Last Year, And Just Turned Coed This Year!! During Ju

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-662HUNTA662hunta00662
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-03-21
    218 min

    [SW-620]The Schoolgirl I See Every Morning In Knee-High Socks Flashing Her Thighs And Panties Is So Cute, She Makes My Dick Hard. She Gets Angry And Says "You Perv" With Puffed Up Cheeks. But She Quickly Starts To Look At Me With Teary Eyes.

  • mai yahiro censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-620SW6201sw00620
    • 2019-02-21
    186 min

    [SW-614]I See Her Knee-High Socks And Thighs Every Morning. The Panty Shots Of A Cute College Girl Was Giving Me A Boner And She Got Mad At Me, Saying "You're A Dirty Man". But She's Really A Bewitching Tsundere Girl And She Started G

  • reiko mizuki censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-614SW6141sw00614
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-02-22
    223 min

    [SW-540]This Schoolgirl In Knee High Socks Who I Would See Every Morning Was Flashing Panty Shot Action At Me And It Was So Cute That She Got My Dick Hard, And She Squealed, "You're Such A Pervert!" And Puffed Up Her Cheeks In Anger But S

  • sena ai censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-540SW5401sw00540
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2017-10-19
    215 min

    [SW-515]Every Morning I See This Schoolgirl In Her Knee-High Socks, Flashing Her Thighs And Panty Shot Action At Me, And She's So Cute It Makes My Dick Hard, But Then She Gets Mad And Says, "You're Such A Pervert, Big Brother!" But Th

  • censoredschoolgirlsingle workSWswitchraito fuji makotoSW-515SW5151sw00515
    • 2017-10-13
    172 min

    [VRTM-294]We Slipped Some Aphrodisiacs To A Panty Shot Flashing Schoolgirl In A Miniskirt, And She Started Rubbing Her Knee High Socks Together And Wet Her Panties, And Scissor Locked Us In Her Legs And Begged Us To Creampie Her! 3

  • miki aise rina minami censoredcreampieschoolgirlVRTMv r producetiger kosakaiVRTM-294VRTM294h-910vrtm00294
    • 2017-05-11
    119 min

    [MIAE-057]Total Domain A Schoolgirl In Beloved Knee High Socks Yuka Hodaka

  • yuka hotaka censoredschoolgirlbeautiful girlMIAEmoodyzMIAE-057MIAE057miae00057



    • Jav Movie Free Download