jav squirting single work javcensored




FC2MIDVMEYDDASDMIAADTTADNSQTENACRAWDRBDMARALULUSDABSANVENUVENXAPODROYDBBANHND

2021-03-06
119 min

[SSIS-006]Aphrodisiac-Addled Squirting Orgasms - Insanely Sensitive Slut Cums With Her Colossal Tits, Nipples, And Clit Stroked Shion Yumi

  • evening beauty censoredbig titssquirtingSSISs1 no 1 styleinaballSSIS-006SSIS006ssis00006
    • 2021-03-06
    161 min

    [JUL-492]15 Years Of Boring, Mundane Marriage Led To Her "Submissive Desires" Mizuki Narasaki 43 Years Old AV Debut.

  • mizuki narasaki censoredsquirtingmature womanJULmadonnamametaro mamezawaJUL-492JUL492jul00492
    • 2021-03-06
    180 min

    [PRED-294]Sweaty, Orgasmic Sex So Good, You'll Lose Your Mind And Start Shaking Your Ass And Cumming Like A Sexual Beast 9000cc Of Sweat And Bodily Fluids 5100 Orgasms 30000cc Of Squirts Yuki Takeuchi

  • yuki takeuchi censoredcreampiesquirtingPREDpremiummametaro mamezawaelegancePRED-294PRED294pred00294
    • 2021-03-06
    119 min

    [SSIS-008](Abnormal Extreme Climaxes) The Ultimate Erotic Awakening! Waves Of Surging Nonstop Carnal Passion Until She's Totally Satisfied Rena Kodama

  • kodama rena censoredsquirtingbeautiful girlSSISs1 no 1 styleichigoharaSSIS-008SSIS008ssis00008
    • 2021-03-05
    170 min

    [ABW-062]Miss Suzumura Loves Teasing Men! My Teacher Miss Suzumura Lovingly Fucks Me Three Times In A Row! Airi Suzumura

  • suzumura airi censoredsquirtingblowjobABWprestigemichiru sunabsolutelyABW-062ABW062118abw00062
    • 2021-03-05
    147 min

    [PXH-022]I Rented Out A Hot Older Porn Star For The Day And Fucked Her Raw ACT 05 Top Class Porn Star + Perfect Body + Raw Sex Hazuki Wakamiya

  • wakamiya censoredcreampiebig titsPXHprestigecompany matsuoPXH-022PXH022118pxh00022
    • 2021-03-05
    135 min

    [HODV-21556]A Friend In Passing Revenge G*******g Reika Hashimoto

  • reika hashimoto censoredsquirtingsingle workHODVh m pHODV-21556HODV215565642hodv21556
    • 2021-03-05
    210 min

    [ABW-063]A Beautiful Girl, A Private Hot Spring, and Steamy Sex 12 I Rented A Beautiful Girl Out For The Night And Took Her To A Hot Spring In The Mountains Umi Yatsugake

  • yakake umi censoredsquirtingsingle workABWprestigeabsolutelyABW-063ABW063118abw00063
    • 2021-03-05
    118 min

    [HEZ-263]Kyoto Housewife Makes Her Anal Debut At 59! Kyoko Aikawa

  • kyoko aikawa censoredsquirtingmature womanHEZhot entertainmenthatake rihotHEZ-263HEZ26359hez00263
    • 2021-03-03
    150 min

    [PFES-005]You're 99 Guaranteed To Get Laid If She's Had Some Liquor - Nailing A Sloppy Slut Who Flashed You Her Panties Until Dawn - Tsukasa Aoi

  • tsukasa aoi censoredsquirtingsingle workPFESs1 no 1 styleinaballsummer panties festivalPFES-005PFES005pfes00005
    • 2021-03-01
    146 min

    [DKWT-007]This Dirty Married Woman Is So Hot She Should Be Declared A Natural Treasure Amu Hanamiya 28 Years Old Third Year Of Marriage

  • hanamiya amu censoredbig titssquirtingDKWTofficeyoungDKWT-007DKWT00736dkwt00007
    • 2021-02-28
    125 min

    [SGT-054]世田谷の妻たち 唐沢千賀子 SGT-054

  • chikako karasawa censoredcreampiebig titsSGTjewelSGT-054SGT054h-848sgt00054
    • 2021-02-27
    165 min

    [JUFE-262]My Special Summer Break Together With Teacher... Beautiful Y********l in Uniform Having Her Sensitive Body And Beautiful Tits Dirtied By A Middle-Aged Man's Semen

  • satoshi kuruki censoredsquirtinguniformJUFEfitchJUFE-262JUFE262jufe00262
    • 2021-02-27
    118 min

    [MIFD-149]Fresh Face, 20yo - A Sexual Genius, To Say The Least! A Female S*****t Who Works Part-Time At A BBQ Place And Loves Eating Meat Gets Fucked And Squirts In Her Porno Debut! - Rika Yamaguchi

  • rika yamaguchi censoredsquirtingbeautiful girlMIFDmoodyztiger kosakaimoodyz freshMIFD-149MIFD149mifd00149
    • 2021-02-26
    183 min

    [ABW-059]They Couldn't Make A Sound ... While Having Secret Lovey-Dovey Sex "Hard And Tight" Sex Vol.04 You've Never Seen Sex In Such Tight Spaces, Unable To Scream With Pleasure, As They Cum In 3 Total Coverage Fuck Scenes Non Nonour

  • nonoura warm censoredsquirtingsingle workABWprestigemasarupansaabsolutely wonderfulABW-059ABW059118abw00059
    • 2021-02-26
    118 min

    [GNAX-046]Nympho Wives Screaming In Pleasure In The Middle Of The Day - Filthy Fertility Massage They Can't Tell Their Husbands About - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsGNAXnagiranagira kenzoGNAX-046GNAX046h-1345gnax00046
    • 2021-02-26
    124 min

    [SQTE-362]I'm Happy For You To Choke Me! Sex Is So Fun! I Love Cock! Wan Horikita

  • horikita wan censoredsquirtingblowjobSQTEs cuteSQTE-362SQTE362sqte00362
    • 2021-02-25
    123 min

    [FSDSS-178]The Orgasming Babe No Matter How Many Times She Cums, The Furious Piston-Pounding Thrusts Will Never Stop Infinite Orgasms Yui Shirasaka

  • yui shirasaka censoredsquirtingbeautiful girlFSDSSfalenomusetafaleno starFSDSS-178FSDSS1781fsdss00178
    • 2021-02-25
    121 min

    [FSDSS-179]A Fresh Face This 20-Year Old Wants To Fuck 365 Days A Year Her Adult Video Debut Noa Miura

  • miura noai censoredbig titssquirtingFSDSSfalenodragon nishikawafaleno starFSDSS-179FSDSS1791fsdss00179
    • 2021-02-22
    133 min

    [SRMC-029]It Can't Be True That You Can Make Sex Feel 100 Times Better Just Through The Power Of Suggestion! 2 Mizuki Yayoi

  • mizuki yayoi censoredsquirtingbeautiful girlSRMChypnosisrusher miyoshiSRMC-029SRMC029srmc00029
    • 2021-02-22
    129 min

    [OPPW-086]I'm An Evolutionary Man Who Transformed Into A Girl, And Now I'm Better At Squirting Than Ejaculating Ai Sato

  • airi sato censoredsquirtingsingle workOPPWopenipeni world mousouzokukamon seijoiOPPW-086OPPW086oppw00086
    • 2021-02-21
    119 min

    [CAWD-187]First Aphrodisiac Sex: Convulsive Sex With A Bilingual J-cup Female Teacher - Miku Maina

  • maina miku censoredbig titssquirtingCAWDkawaiikyoseiCAWD-187CAWD187cawd00187
    • 2021-02-21
    116 min

    [CJOD-282]"I Told You I've Already Ejaculated!" The Soapland Of Agony Unlimited Creampie Ejaculations! Follow-Up Man-Squirting! An Orgasmic Full Course Of Erotic Semen-Squeezing Yukino Nagisa

  • yukino nagi censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-282CJOD282cjod00282
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-19
    233 min

    [BGN-062]Erotic Infinity - Bursting Past The Limit With H-Cup Boobs! Exclusive Debut! Yuka Yuizuki

  • yuzuki yuuka censoredbig titssquirtingBGNprestigemanhattan kimurabeginningBGN-062BGN062118bgn00062
    • 2021-02-19
    131 min

    [BIJN-194]The Document - Instinctive, Orgasmic Sex Caught On Camera - Screaming, Swooning Orgasms, Beautiful BODY - Extreme Climaxes Hazuki Wakamiya

  • wakamiya censoredbig titssquirtingBIJNbijin majo emmanuelleBIJN-194BIJN194bijn00194
    • 2021-02-18
    155 min

    [MVSD-454]A College Girl Who Had Fallen So Far, She Was Now Working At A Low-Class Raw Fuck Soapland I Hated My Homeroom Professor So Bad I Could Die, But Now I Had To Service His Cock And Do As He Said And He Creampie Fucked Me. Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMVSDm s video groupMVSD-454MVSD454mvsd00454
    • 2021-02-18
    157 min

    [SSNI-996]It's Her First Anniversary Since Her Debut! She's Lifting Her Ban On Amateur Men! When She Takes Off Her Coat, She'll Be Hugging You Within 5 Seconds She's Going To Throw Herself Into Providing All The Hospitality She Can To

  • izuna maki censoredsquirtingsingle workSSNIs1 no 1 styleinaballSSNI-996SSNI996ssni00996
    • 2021-02-18
    116 min

    [PPPD-906]Side-Boob Erogenous Zone Development Clinic Saeko Hiiragi

  • hiiragi saeko censoredbig titssquirtingPPPDoppaiPPPD-906PPPD906pppd00906
    • 2021-02-18
    119 min

    [SSNI-994]Female Undercover Investigator - Hooked On An Aphrodisiac, This Busty Spy Is Corrupted By Pleasure Mei Washio

  • mei washio censoredbig titssquirtingSSNIs1 no 1 styleichigoharaSSNI-994SSNI994ssni00994
    • 2021-02-16
    132 min

    [KMHRS-039]Product Name: Colorless, Transparent Natural Juices From Unspecified Girl - Contents: Sweat, Pussy Juices, Spit, Cum, Piss - Misuzu Miyamori

  • misuzu miyamori censoredsquirtingamateurKMHRSsod creatememe akiyamakimihoreKMHRS-039KMHRS0391kmhrs00039
    • 2021-02-16
    483 min

    [STARS-333]Nanase Asahina 's SOD Star Graduation. Endless Hard Drilling Non-Stop Pounding All Facials 15-Load Special!

  • asahina nanase censoredsquirtingbeautiful girlSTARSsod createafro takahashisod starSTARS-333STARS3331stars00333
    • 2021-02-14
    123 min

    [NJP-001]精液私に下さい 池澤十和子

  • towako ikezawa censoredcreampiesquirtingNJPjeweljueruNJP-001NJP001h-848njp00001
    • 2021-02-13
    139 min

    [SQTE-358]Beautiful Girl With Black Hair Loves Having Sex And Receiving Creampies - Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingSQTEs cuteSQTE-358SQTE358sqte00358
    • 2021-02-13
    133 min

    [CESD-976]Slut Gets Horny And Wets Herself When She Puts Glasses On - Momo Kato ka

  • kato momoka censoredsquirtingmature womanCESDceleb no tomoCESD-976CESD976cesd00976
    • 2021-02-12
    149 min

    [IPX-606](Total Orgasms) G-Spot Climaxes Developed! Earth-Shattering Ecstasy - Swooning For The Ultimate Fucks - Pushed Past Her Limit! Iyona Fujii

  • iyo fujii censoredsquirtingblowjobIPXidea pocketusa pyondishIPX-606IPX606ipx00606
    • 2021-02-12
    171 min

    [XRW-980]Big Titted Married Woman, Aphrodisiac Confinement And Cumming Yuri Honma

  • really censoredcreampiebig titsXRWreal worksani nakamurareal real worksXRW-980XRW980172xrw00980
    • 2021-02-12
    196 min

    [ABW-054]Mine And Remu's Fantasy World Sex Life ACT. 07 - Breaking Through All Erotic Borders With The Strongest Sexy Armor!!! Remu Suzumori

  • suzumori remu censoredbig titssquirtingABWprestigemichiru sanabsolutely wonderfulABW-054ABW054118abw00054
    • 2021-02-12
    162 min

    [MIDE-884]Abstinence Sensitive Pussy: Convulsions, Screaming Acme Squirting From Hard Piston Fuck - Mia Nanasawa

  • nanasawa mia censoredsquirtingbeautiful girlMIDEmoodyzzaku araimoodyz divaMIDE-884MIDE884mide00884
    • 2021-02-12
    119 min

    [JUFE-257]Dense Licking Sexual Intercourse, Dripping Juices While Staring At A Man - Karen Usui

  • usui ren censoredsquirtingblowjobJUFEfitchJUFE-257JUFE257jufe00257
    • 2021-02-12
    145 min

    [IPX-607]Hey, Hey, You Wanna Fuck？ Sucking School Life With A Super Cute Beautiful Y********l In Uniform Amu Amatsuka

  • amatsuka amu censoredsquirtingschoolgirlIPXidea pocketdishIPX-607IPX607ipx00607
    • 2021-02-12
    139 min

    [KNAM-033]Totally Raw [email protected] # A Cheerful Creampie Girl # Cum On And Creampie Me # Demonic Lust # The Strongest Beautiful Girl # SSS-Class No.1 # Raw Pay-For-Play Natsu Tojo

  • natsu tojo censoredcreampiesquirtingKNAMfirst star100 raw styleKNAM-033KNAM033h-491knam00033
    • 2021-02-12
    125 min

    [IPX-611]I Give Up... Do Whatever You Want To Me - Sizzling Hot Sub Tied Up For Extreme Orgasmic Ecstasy With Relentless Fucks Anna Kami

  • anna kami censoredsquirtingsingle workIPXidea pocketdishIPX-611IPX611ipx00611
    • 2021-02-12
    118 min

    [IPX-616]His S*****t's Wet Uniform Looks Too Enticing... On Rainy Days, She's Definitely Going To Get Ravished Yume Nishimiya

  • yume nishinomiya censoredsquirtingschoolgirlIPXidea pocketamazing meatdishIPX-616IPX616ipx00616
    • 2021-02-12
    151 min

    [EBOD-803]119 Climaxes! 104 Spasms Of Ecstasy! 2300 mL Of Squirting! Slim, Beautiful Babe With Big Tits Who Works As A Nurse And Social Media Influencer Takes Her First Creampie & Raw Fuck - On Camera! Mikako Horiuchi

  • mikako horiuchi censoredcreampiebig titsEBODe bodymon cEBOD-803EBOD803ebod00803
    • 2021-02-11
    111 min

    [NEO-752]A Slut Squirting Her Bodily Fluids Holy Water - Rika Aimi

  • rumi tadami censoredsquirtingslutNEOradixshio sakurabaneo paradoxNEO-752NEO752433neo00752
    • 2021-02-11
    121 min

    [FSDSS-170]Their Genes Want Each Other, Instinctual Fucking, Uncut Collection Ayaka Tomoda

  • ayaka tomoda censoredcreampiesquirtingFSDSSfalenopremium takanofaleno starFSDSS-170FSDSS1701fsdss00170
    • 2021-02-11
    121 min

    [FSDSS-171]All The Way For The First Time, Unexperienced Play Special, Meisa Kawakita

  • kawakita meisa censoredsquirtingblowjobFSDSSfalenomusetafaleno starFSDSS-171FSDSS1711fsdss00171
    • 2021-02-09
    140 min

    [STARS-340]Body Covered In Love Juices: Thick, Wet, Sweaty Intercourse - Kurumi Hanamaru

  • hanamaru kurumi censoredbig titssquirtingSTARSsod createmid eyesod starSTARS-340STARS3401stars00340
    • 2021-02-09
    125 min

    [KTRA-272]Creampie Escort Sex With Your Busty Stepsister Mizuki Yayoi

  • mizuki yayoi censoredbig titssquirtingKTRAk tribeKTRA-272KTRA272h-094ktra00272
    • 2021-02-06
    150 min

    [SSNI-986]142 Extreme Orgasms! 5500 Body-Wracking Spasms! 2200 cc Of Squirting! Sexy, Slender, Barely Legal Babe Destroyed With Orgasms - Her Ecstatic Erotic Awakening And Retirement Special Kanon Tsukishima

  • tsukishima kanon censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-986SSNI986ssni00986
    • 2021-02-06
    149 min

    [ADN-292]So Long As She's Convenient, I'll Fuck Her. Slut Loses Control And Sleeps With Her Married Boss. Kana Yume

  • kana yui censoredsquirtingsingle workADNattackersjo styleotona no dramaADN-292ADN292adn00292
    • 2021-02-06
    121 min

    [SSNI-983]This Fresh Face Manager Will Usually Manage The Team With A Smile On Her Face, But The Truth Is She Cannot Physically Handle Being Around The Big Dick Team Members, But After The Game, They Were Pumped Up And Full Of Adrenaline, And So... L

  • kodama rena censoredsquirtingsingle workSSNIs1 no 1 stylesuisei akaiSSNI-983SSNI983ssni00983
    • 2021-02-06
    159 min

    [PRED-288]Squirting, Sweat, Saliva, Semen, And Other Secretions... Long-Haired Slut Dripping Wet With All Your Sex Juices Yuki Takeuchi

  • yuki takeuchi censoredcreampiesquirtingPREDpremiumkogoro kindaichielegancePRED-288PRED288pred00288
    • 2021-02-05
    177 min

    [ABW-053]The Spring Of Youth This Is The Story Of The 3 Fucks I Had With A Beautiful Y********l In Uniform In This Totally POV Video. #02 The Sexy And Bittersweet Graffiti Of Youth 4 Episodes That You Can Experience Entirely From Your Own Perspective

  • yakake umi censoredsquirtingcosplayABWprestigeshiko tissue fuwafuwaabsolutely wonderfulABW-053ABW053118abw00053
    • 2021-02-05
    123 min

    [HODV-21548]G*******ging Sex 30 Bukkake Cum Face Creampie Cum Shots Reika Hashimoto

  • reika hashimoto censoredsquirtingsingle workHODVh m pHODV-21548HODV215485642hodv21548
    • 2021-02-02
    140 min

    [MSFH-049]Slick, Sweaty Bodies Slippery With Sex Fluids Konomi Yoshinaga

  • konomi yoshinaga censoredsquirtingsingle workMSFHsod createkyoseims sodMSFH-049MSFH0491msfh00049
    • 2021-02-02
    138 min

    [SDMM-084]Going For The Dickhead So Hard It's About To Fly Off As He Screams And Shoots His Load Into The Skies!! First Male Squirting Challenge!! Muscle You*uber Chanyota's Shows Off Her Slutty SK**ls In Reverse Pick Up Special!! Hard Grip C

  • chanyota censoredslutsingle workSDMMsod createzampamagic mirrorSDMM-084SDMM0841sdmm00084
    • 2021-02-01
    131 min

    [EKDV-654]Spread Wide For Intense Orgasms! Mind-Blowing Climaxes! Squirting! G-Spot Training Sex Rei Kuruki

  • satoshi kuruki censoredsquirtingblowjobEKDVcrystal eizoharuo miyafujie kissEKDV-654EKDV65449ekdv00654
    • 2021-02-01
    167 min

    [BBACOS-027](Shame) Babacosplay! (BBA) These Old Wives Are Old But Enjoy The Shame Of Re: Little Stepsister Cosplay (Creampie Sex) First Chapter Ms. Nozomi Haneda 35 Years Old

  • nozomi haneda censoredcreampiebig titsBBACOSplumposting gt jiro in asakusashirouto only plumBBACOS-027BBACOS027h-113bbacos00027



    • Jav Movie Free Download