censored high vision virgin upskirt jav




FC2BBANGVHMIDVHODVMARAMILKHMNAWDCESDHNDFSDSSATIDMEYDCAWDNACRMIDEVENULULUSHKDNNPJ

2022-01-07
217 min

[HUNTB-182]Virgin Father. 18 Years Ago, I Became a Virgin Father. For 18 Years, I"ve been Raising my Best Friend"s C***d Like a Father. I Haven"t Told the Real Father Yet. I was a Virgin Back Then...

  • censoredschoolgirlblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-182HUNTB182huntb00182
    • 2021-07-14
    204 min

    [HUNTB-061]"If You Keep Pounding Me Like This I'm Going To Lose It!" Virgin Cherry Boy Has It Popped By His Slutty Stepsister And Drives Her To A Real Orgasm! Pinned With Her Tight Legs Wrapped Around Him...

  • censoredcreampieschoolgirlHUNTBhuntermorikihhh groupHUNTB-061HUNTB061huntb00061
    • 2021-05-08
    123 min

    [PARM-166]Barely Legal Daydream Situation

  • kiriyama yuu ichinose love censoredslutPARMaroma planningmoso chirarizumuPARM-166PARM166parm00166
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2020-08-01
    239 min

    [HUNTA-823]"You Got Hard For Me？" "Oh No! I Might Wanna Fuck!？" My Friend's (Slut) Won't Stop Squeezing My Virgin Dick And Makes Me Creampie Her Over And Over!

  • censoredcreampieslutHUNTAhuntermorikihhh groupHUNTA-823HUNTA823hunta00823
    • 2019-11-09
    118 min

    [MIAA-185]A Cherry Boy Little Stepbrother Who Took His Big Stepsister's Provocations Seriously And Didn't Realize That She Had Already Cum And Kept On Pumping Away At Her Pussy With Out-Of-Control Fury Kanon Kanade

  • kanon kanon censoredschoolgirlbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-185MIAA185miaa00185
    • 2019-09-26
    140 min

    [KMHR-081]Arare Mochizuki Total Domain Her Excessively Sexy Smooth Thighs & Panty Shot Action Are Luring Her Cherry Boy Students To Temptation A Private Tutor In Knee-High Socks

  • mochizuki hail censoredsingle workKMHRsod creategoemoni fell in love with youKMHR-081KMHR0811kmhr00081
    • 2019-09-20
    241 min

    [DOCP-172]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again! vol. 2

  • yui nagase natsuho imai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-172DOCP172118docp00172
    • 2018-12-13
    235 min

    [GDHH-132]My Big Sister Is A Slut That Specializes In Stealing Men's Virginity! When I Bring My Cherry-Boy Friends Home, She Tempts Them By Flashing Her Panties And Tits! "Stop That!" I Kick Her Out Of My Room, But She Somehow Ends Up Alo

  • censoredGDHHgolden timerobby kunhhh groupGDHH-132GDHH132gdhh00132
    • 2018-12-07
    219 min

    [DOCP-110]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again!

  • aoi kururugi yuki sahara censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-110DOCP110118docp00110
    • 2018-10-07
    223 min

    [HUNTA-501]This Naive Girl Said That She Was A Slut, So When I Egged Her On, I Was Able To Fuck Her! There's This Bitchy Girl In My Class Who Pretends To Be A Slut But Even A Cherry Boy Like Me Can Tell That She's Not Really A Slut She Kept O

  • censoredschoolgirlHUNTAhuntermorikihhh groupHUNTA-501HUNTA501hunta00501
    • 2018-10-07
    240 min

    [DVDMS-317]A Normal Boys And Girls Focus Group AV We Negotiated With This Boy And His Female Classmate As They Were Walking Home From School! "Would You Help Your Cherry Boy Friend With His Masturbation？" The Cutest Girl In Class Is Bashfully

  • censoredschoolgirlamateurDVDMSdeep scherie komabaDVDMS-317DVDMS317dvdms00317
    • 2018-02-08
    145 min

    [IENE-860]No Matter How Many Times She Cums, This Orgasmic Cherry Boy Won't Stop His Hard Piston Thrusts! His Big Tits Big Sister-In-Law Tries To Escape, But He'll Keep Cumming After Her And Fucking Her Brains Out! "Please Stop! I've

  • censoredbig titssisterIENEienergyie nergyIENE-860IENE8601iene00860
    • 2017-11-04
    213 min

    [GDHH-077]"Do You Really Want Your First Time To Be With An Old Lady Like Me？？" I Had The Best Cherry Boy Popping Ever With My Friend's Mother! My Friend's Mother Is Always Prancing Around Looking Sexy And Hot! She Never Wears A Bra!

  • censoredcreampiemomGDHHgolden timebenzo sanhhh groupGDHH-077GDHH077gdhh00077
    • 2017-06-23
    151 min

    [SCPX-210]My Little Sister Got Her Panties Dripping Wet After Watching Some Incest AV!! I'm A Cherry Boy And I Was Hiding Some Brother And Sister AV Videos, But My Little Sister Found Them, And When I Peeked Under Her Skirt, I Found Out Her Panti

  • censoredcreampiesisterSCPXscoopone topmousouzokuSCPX-210SCPX210h-565scpx00210
    • 2017-05-26
    173 min

    [SCPX-204]"Do boys really like it when girls flash their panties？" the girls ask me. I don't talk much, which makes me the perfect crash test dummy for the girls in my class that want to try out sexual stuff. They call me a freak and a pe

  • censoredcreampieschoolgirlSCPXscoopkijin kasaimousouzokuSCPX-204SCPX204h-565scpx00204
    • 2017-05-18
    180 min

    [SW-484]My Friend's Mom Is Giving Me A Horny Sex Education She Lured Me With Her Hot Cleavage And Got My Cock Rock Hard For A Very Adult Lesson In Sex

  • censoredbig titsmature womanSWswitchyocchanswitch switchSW-484SW4841sw00484
    • 2017-02-05
    214 min

    [HUNTA-255]A Horny Cherry Boy Loser In Creampie Fucking! I Quit My Job After 3 Days And Now I'm A Cherry Boy Loser Living At Home My Big Brother Has A Good Job And Married To A Pretty Lady And Also Lives At Home Too I've Never Lived With Anot

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-255HUNTA255hunta00255
    • 2017-02-05
    242 min

    [GDHH-041]My Childhood Friend Is Having An Orgasm With Her Vibrator!？ My Childhood Friend Is Always Barging Into My Room And Making Fun Of Me For Being A Cherry Boy! Finally She Pissed Me Off One Time Too Many, So I Got Revenge By Giving Her The Elec

  • censoredschoolgirlGDHHgolden timebenzo sanhhh groupGDHH-041GDHH041gdhh00041
    • 2016-12-08
    205 min

    [SW-450]I Was A Total Loser With The Ladies So My Big Brother's Wife Started To Secretly Lure Me To Temptation And Now My Unpopped Cherry Is On The Verge Of Detonation Are You Still Going To Let Me Fuck You While My Big Brother Is Nearby？

  • censoredSWswitchyocchanSW-450SW4501sw00450
    • 2016-09-22
    180 min

    [SW-435]So My Big Sis Is Bringing Over Her Friends To Have A Sleepover!？ 2 A Panty Shot Will Make My Cock Rock Hard And They Each Told Me, "This Will Be Our Little Secret" And Gave Me A Hardcore Lesson In Adult Fun

  • censoredblowjobSWswitchyocchanswitch switchSW-435SW4351sw00435
    • 2016-08-06
    130 min

    [SW-428]Naughty Married Woman Lends A Keen Male Student Some Erotica At A Bookstore. "I'm Bored And I Want A Hard Young Dick" She Muffles Her Own Moans So That The Clerk And The Other Patrons Won't Hear Her Taking His Virgin Seed Over

  • censoredSWswitchyamashiro takeshiSW-428SW4281sw00428
    • 2014-05-10
    127 min

    [IENE-410]Unlucky with Women, I'm Still a Virgin, but My House That's Right Next to a Park Has Become a Hangout for Barely Legal Girls Who Ditched Cram School or Other Classes and Don't Want to Go Home Yet! Being Continuously Shown Their

  • censoredcreampiebig titsIENEienergyie nergyIENE-410IENE4101iene00410



    • Jav Movie Free Download