censored beautiful girl debut work javcensored jav




FC2HZGDBBANABWHUNTBMIDVNATRMILKCHRVMIAASSNISPRDMIDESSISSTARSFSDSSGVHSANAUKGKBIMVSD

2020-07-07
179 min

[STARS-264]Mei Miyajima Is Having Her AV Debut. But She's Retiring Now.

  • mei miyajima censoredbeautiful girlsingle workSTARSsod createzampasod starSTARS-264STARS2641stars00264
    • 2020-07-07
    483 min

    [STARS-274]Makoto Toda 4th Anniversary Debut, Latest 24 Works, SEX 8 Hours BEST!!!!

  • makoto toda censoredcreampiesquirtingSTARSsod createsod starSTARS-274STARS2741stars00274
    • 2020-07-04
    214 min

    [DVDMS-555]Between Innocence And All Grown Up A 19-Year Old Fresh Face Mei Satsuki Her Adult Video Debut Documentary Born And Raised In Yamagata We Met This College Girl Who We Could Not Seduce On The Magic Mirror Number Bus, But Now, She's Havin

  • satsuki mei censoredbig titsbeautiful girlDVDMSdeep sgreenhouse effectDVDMS-555DVDMS555dvdms00555
    • 2020-07-03
    485 min

    [HODV-21494]Moa Aozora Best 8 Hours - Early Debut Full Record

  • the starry sky censoredbig titsbeautiful girlHODVh m pHODV-21494HODV214945642hodv21494
    • 2020-07-03
    60 min

    [PARATHD-2928]Innocent Girl From The Sticks Comes To Tokyo To Make A Porno (1) - Izumi The Sub Loves To Take It Doggie-Style

  • censoredamateurbeautiful girlPARATHDparadise tvPARATHD-2928PARATHD2928parathd02928
    • 2020-06-27
    184 min

    [MIDE-790]A Fresh Face Adult Video Debut A College Girl Idol Under Management Suspends Her Activities G-Cup Titties Ibuki Aoi 19 Years Old

  • aoi ibuki censoredbeautiful girlsingle workMIDEmoodyzusa pyonmoodyz divaMIDE-790MIDE790mide00790
    • 2020-06-27
    118 min

    [MIFD-125]A Fresh Face Girl Who's Super Honest And Seriously Sensual! A Girl With Short Hair And A Great Personality Who's Only Had One Sexual Partner Wants To Increase That Number To Three So That's Why She's Making Her Adult Video D

  • rin kubo censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-125MIFD125mifd00125
    • 2020-06-27
    152 min

    [MIFD-124]A Fresh Face! She Loves To Eat! A Real-Life G-Cup Titty College Girl Who Is The Life Of The Party Is Making Her Adult Video Debut!! Erica Narumiya

  • narimiya erika censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-124MIFD124mifd00124
    • 2020-06-25
    137 min

    [FSDSS-043]Fresh Face FALENO Star Exclusive - Determination AV DEBUT - Kaname Momojiri

  • kaname momojiri censoredbig titsbeautiful girlFSDSSfalenofaleno starFSDSS-043FSDSS0431fsdss00043
    • 2020-06-20
    152 min

    [CAWD-097]Cute Short Rhythm - She Looks Boyish But She Loves Sex! - Her Slender Body Has A Masochistic Awakening! - Mashiro Kisaragi - Kawaii* Exclusive Debut!

  • kisaragi mashiro censoredbeautiful girlsingle workCAWDkawaiiusa pyonCAWD-097CAWD097cawd00097
    • 2020-06-20
    130 min

    [CAWD-098]A Shy Girl With A Natural Anime Voice, Glasses, And Beautiful Sensitive Tits - Her One And Only Porn Appearance - Mina Horikoshi

  • horikoshi mina censoredsingle workCAWDkawaiikannana dainanaCAWD-098CAWD098cawd00098
    • 2020-06-16
    125 min

    [MXGS-1141]A Fresh Face Sayuri Shiina A Female S*****t With A Tight Athletic Body Her Adult Video Debut

  • sayuri shiina censoredbeautiful girlsingle workMXGSmaxingMXGS-1141MXGS1141h-068mxgs01141
    • 2020-06-12
    200 min

    [SKMJ-105]I Have Experience With No One Satomi Honda AV Debut

  • honda satomi censoredbeautiful girlsingle workSKMJceleb no tomoone topred face girlSKMJ-105SKMJ105h-1324skmj00105
    • 2020-06-11
    153 min

    [MIFD-120]Fresh Face Dream Is The World! Dance Team Captain! A Super Cute Spunky College Girl AV Debut!! Sara Urugi

  • uryuki sara censoredbeautiful girlsingle workMIFDfalenousa pyonmoodyz freshMIFD-120MIFD120mifd00120
    • 2020-06-11
    76 min

    [EMOI-014]A Shy, Emotional Girl Makes Her Porno Debut - A Real Angel - 142cm Tall, C-Cup Tits, Music S*****t, 19yo - Haru Itou

  • ito haru censoredamateurbeautiful girlEMOIsilk labotiger kosakaiemotional girlEMOI-014EMOI0141emoi00014
    • 2020-06-05
    139 min

    [DIC-073]18 Years And 3 Months 16 A Beautiful Girl With Light Skin Who Cums Hard Through Her Pussy Sena Nanami

  • nanami sena censoredanalsingle workDICprestigekimura manhattandiscoverDIC-073DIC073118dic00073
    • 2020-06-02
    486 min

    [STARS-271]Debut 2 Year Anniversary, 19 Fucks, 8 Hour Complete Special Collection [2 Disc Set] Mahiro Tadai

  • mahiro yui censoredbeautiful girlsingle workSTARSsod createsod starSTARS-271STARS2711stars00271
    • 2020-05-30
    152 min

    [MIFD-117]A Fresh Face A Beautiful Girl With A Country Accent And A Great Personality Her Adult Video Debut Nozomi Ishihara

  • ishihara hope censoredblowjobbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-117MIFD117mifd00117
    • 2020-05-30
    179 min

    [MIFD-119]A Fresh Face I'm Intrigued By This Big Tits Girl This Bunny-Like Excessively Orgasmic College Girl Goes To Veterinary School And Now She's Making Her Adult Video Debut Ami Kashiwagi

  • ami kashiwagi censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-119MIFD119mifd00119
    • 2020-05-30
    150 min

    [MIFD-118]This Woman Looks Like A Cute College Girl, But She's Actually A Married Woman Who's Given Birth Four Times! - Yuika Kizaki

  • kizaki yui flower censoredbeautiful girlsingle workMIFDmoodyzmametaro mamezawamoodyz freshMIFD-118MIFD118mifd00118
    • 2020-05-23
    135 min

    [HND-835]Ever Since She Was A S*****t, She Won Every Award There Was To Win! An Incredibly Horny 22-Year Old Real-Life Athlete Is Volunteering To Get Creampie Fucked In Her Adult Video Debut Nana Kuroda

  • nana kuroda censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-835HND835hnd00835
    • 2020-05-23
    148 min

    [CAWD-085]"Please Teach Me How To Have Sex" A Lovely 18-Year Old With A Brilliant Smile Is Stealing Our Hearts Right After Her Graduation Ceremony Suzu Kiyomizu Her Adult Video Debut

  • kiyomiya suzu censoredbig titsblowjobCAWDkawaiimichiru arashiyamaCAWD-085CAWD085cawd00085
    • 2020-05-23
    160 min

    [HND-833]This Beautiful Girl Is Working Every Day At A Part-Time Job At This Fashionable Cafe In Meguro. And She Has A Lovely Smile She's Keeping A Secret From Her Friends And Co-Workers: She's Making Her Creampie Adult Video Debut!! Kurumi I

  • kurumi ito censoredcreampieblowjobHNDhon nakahirokoji osakiHND-833HND833hnd00833
    • 2020-05-23
    163 min

    [CAWD-087]A Tanned And Healthy Beautiful Girl With A Refreshing Smile, Born From The Islands Of Hawaii A Kawaii* Debut

  • censoredbig titssquirtingCAWDkawaiikyoseiCAWD-087CAWD087cawd00087
    • 2020-05-22
    240 min

    [MBM-162]Simply, the Best. First Time Filming The Lewdest Sex With Enchanting Top Class Girls 6 Girls 240 Minutes 02

  • censoredbeautiful girlMBMprestigetakayama coin chestmbmMBM-162MBM162118mbm00162
    • 2020-05-22
    95 min

    [EMOI-009]An Emotional Girl / Shy For Appearance In AV (Debut) / We Love Mana Sakura / D-cup / 155cm Tall / Currently 2nd Year University S*****t / Mao Watanabe (19)

  • mao watanabe censoredamateurblowjobEMOIsod createbacon tanakaemotional girlEMOI-009EMOI0091emoi00009
    • 2020-05-16
    152 min

    [SSNI-779]Fresh Face NO. 1 STYLE: Sayaka Otoshiro AV Debut

  • otoshiro sayaka censoredblowjobbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-779SSNI779ssni00779
    • 2020-05-12
    149 min

    [YAKO-008]That Girl I Would Always See At The Laundromat Would Take Off Her Underwear And Wash It Right There, Because She's A Wild Big Tits Girl With G-Cup Titties Rino I Seduced Her And Started Fucking Her, And Then She Gave Me Full-Body Lip Se

  • censoredbig titsamateurYAKOmercuryshinjuku undergroundYAKO-008YAKO008h-1133yako00008
    • 2020-05-09
    118 min

    [MIDE-770]18 Year Old Rikka Ono New Face Debut

  • rokka ono censoreduniformblowjobMIDEmoodyzusa pyonmoodyz divaMIDE-770MIDE770mide00770
    • 2020-05-09
    120 min

    [MIFD-116]Furious, Explosive Desires To Give A Blowjob This College Rugby Team Manager Will Somehow Manage To Make Her Adult Video Debut Kazusa Kohinata

  • koinata kazusa censoredblowjobbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-116MIFD116mifd00116
    • 2020-05-06
    223 min

    [SDJS-066]Her Adult Video Debut A Half-Japanese Girl From The Southern Tropics An SOD Female Employee Her First Year After Graduation Rin Miyazaki

  • miyazaki rin censoredbeautiful girlsingle workSDJSsod createkomatsu 17sod female employeeSDJS-066SDJS0661sdjs00066
    • 2020-04-27
    134 min

    [FONE-107]Risako Is A Tanned, Buff, Charismatic Spartan Instructor! Watch Her Make Her AV Debut!

  • censoredcreampieamateurFONEfirst starplus first starFONE-107FONE107h-491fone00107
    • 2020-04-25
    150 min

    [MIFD-112]Working For The Knee High Socks Project Planning And Development Department Of A Famous Apparel Company! This Newly Graduated, Tall Girl Landed A Provisional Offer By Showing Off Her Total Domain, And Now Makes Her AV Debut Haruka

  • haruka censoredbeautiful girlsingle workMIFDmoodyzmon cmoodyz freshMIFD-112MIFD112mifd00112
    • 2020-04-25
    120 min

    [MIFD-113]A Blinding Smile! Dark Skin The Color Of Wheat Grains! Natural F Cup! Fresh 19 Year Old Face From The Southern Islands: The Sunny AV Debut of Michiru Shigemoto

  • shigemoto michiru censoredbig titsbeautiful girlMIFDmoodyzmametaro mamezawamoodyz freshMIFD-113MIFD113mifd00113
    • 2020-04-24
    192 min

    [BGN-057]An Prestige Exclusive Fresh Face Debut A Beautiful Girl Who Bashfully Loves Sex Natsuna Kawaguchi

  • natsuna kawaguchi censoredsquirtingsingle workBGNprestigekimura manhattanbeginningBGN-057BGN057118bgn00057
    • 2020-04-21
    132 min

    [SDJS-064]Great News! This Freshly Graduated Newbie Is Making Her Long-Awaited Adult Video Debut! An Office Idol! Sexy And Cute Nakayama-chan (22 Years Old) Kotoha Nakayama

  • kotoba nakayama censoredamateurbeautiful girlSDJSsod createkirinsod female employeeSDJS-064SDJS0641sdjs00064
    • 2020-04-19
    132 min

    [DASD-667]This Girl Was A Member Of A Major Idol Group. We Can't Tell You Her Name, But She's A Pretty Big Deal. See Her Exclusive AV Debut. Shizuku Asahi

  • asahi drop censoredbeautiful girlsingle workDASDdasrokusaburo mishimaDASD-667DASD667dasd00667
    • 2020-04-16
    149 min

    [SSNI-755]Amateur No. 1 Style Sakura Kageyama Porn Debut

  • kageyama sakura censoredblowjobbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-755SSNI755ssni00755
    • 2020-04-12
    151 min

    [FONE-104]Pre-Debut Footage Of Mihina Filmed And Directed By Her Fuck Buddy: She Has Never Been Seen In This Much Pleasure Before! Full Body Erogenous Zone 7-Hole Anal Sex

  • mihina azumihina mihina nagai censoredanalcreampieFONEfirst starplus first starFONE-104FONE104h-491fone00104
    • 2020-04-11
    118 min

    [MIFD-110]A Fresh & Cute New Face! The AV Debut Of A Short Haired Beauty Who Always Gives Her All: In Love, At Her School Club, And Even When She Fucks! Saki Shida

  • saki shida censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-110MIFD110mifd00110
    • 2020-04-09
    126 min

    [FSDSS-026]Fresh Face - Virus International Japan Representative - Porno Debut - Yume Nikaidou

  • nikaido yume censoredsquirtingbeautiful girlFSDSSfalenofaleno starFSDSS-026FSDSS0261fsdss00026
    • 2020-04-02
    63 min

    [EMOI-003]An Emotional Y********l/Her First Adult Video Performance (Debut) Rina Hiyuga (22 Years Old)/Her First Year As An Adult In The Working World/148cm Tall/B-Cup Titties/It's Been 3 Months Since She Arrived In Tokyo/Personality: "Spoile

  • hyuga rina censoredbeautiful girlsingle workEMOIsod createhajime yanaiemotional girlEMOI-003EMOI0031emoi00003
    • 2020-03-29
    176 min

    [KTKZ-068]A Skinny Virgin Has Her First Experience - A Beautiful Girl Cries As She Loses Her Virginity - Ui Hatsushima

  • hatsushima ui censoredsingle workKTKZkitixx mousouzokushiroshinjinKTKZ-068KTKZ068ktkz00068
    • 2020-03-28
    151 min

    [MIFD-108]The Adventure Of A 19-Year Old Making Her AV Debut: There's Nothing To Do Out In The Sticks! A College Girl Who Hates Being Bored: Erina Oka

  • hill erina censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-108MIFD108mifd00108
    • 2020-03-24
    62 min

    [EMOI-001]Emotional Girl / Embarrassing AV Debut / Emi Suzuka (23) / First-Year Office Worker / 157 cm Tall / B-Cup / Timid And Shy Personality

  • emi suzukaze censoredbeautiful girlsingle workEMOIsod createhajime yanaiemotional girlEMOI-001EMOI0011emoi00001
    • 2020-03-21
    150 min

    [CAWD-070]Batter Up! - This Angelic High S*********l Is Doing Her Best As The Manager Of The Baseball Team - Minagi Kubo - Porno Debut

  • kubo minagi censoredbeautiful girlsingle workCAWDkawaiikyouseiCAWD-070CAWD070cawd00070
    • 2020-03-21
    120 min

    [HND-805]A Fresh Face She Was Born In 2000 And Now She's Almost 20 Years Old A College Girl Who Grew Up In Fukuoka And Attends A Famous Women's University Is Making Her Adult Video Debut Minami Koga

  • minami koga censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-805HND805hnd00805
    • 2020-03-21
    146 min

    [CAWD-069]She's Tiny But She Loves Big Dicks! This No-Nothing 147cm-Tall Minimum Barely Legal Babe Is Making Her Adult Video Debut Kotori Takanashi

  • kotori takanashi censoredcreampiesquirtingCAWDkawaiitake dCAWD-069CAWD069cawd00069
    • 2020-03-10
    189 min

    [STARS-213]Nanase Asahina AV DEBUT

  • asahina nanase censoredsquirtingbeautiful girlSTARSsod createkyoseisod starSTARS-213STARS2131stars00213
    • 2020-03-10
    183 min

    [SDAB-122]A Real Idol Who Has A Naughty Side - Risa Shiroki - SOD Exclusive - Porno Debut

  • risa shirojo censoredbeautiful girlsingle workSDABsod createhajime yanaione s youthSDAB-122SDAB1221sdab00122
    • 2020-03-08
    176 min

    [IPX-448]Fresh Face Adult Video Debut FIRST IMPRESSION 139 A Sweet And Spoiled Cheery Girl - A Barely Legal With Beautiful F-Cup Big Tits - Hikari Azusa

  • azusa hikari censoredbig titsbeautiful girlIPXidea pocketusa pyondishIPX-448IPX448ipx00448
    • 2020-03-08
    149 min

    [MIFD-107]Beautiful And Rebellious Mixed Race Girl From A Good Family Gets Tattoos And Becomes A Porn Star Because She Loves Dominating Men! Urara Uraraka

  • beautiful censoredslutsingle workMIFDmoodyzmon cmoodyz freshMIFD-107MIFD107mifd00107
    • 2020-03-08
    179 min

    [MIDE-747]Fresh Face Debut! - The Last Big Adventure Of Her Teens - Yui Kawai

  • yui kawai censoredsquirtingblowjobMIDEmoodyzkyoseimoodyz divaMIDE-747MIDE747mide00747
    • 2020-03-08
    144 min

    [MIFD-104]A Fresh Face 20-Year Old A Sweet-Faced Natural Airhead College Girl Who's So Soft And Cute, You'll Want To Make Her Your Pet And Now She's Making Her Debut Momo Tsujisawa

  • momo tsujizawa censoredbeautiful girlsingle workMIFDmoodyzmametaro mamezawamoodyz freshMIFD-104MIFD104mifd00104
    • 2020-02-29
    149 min

    [MIFD-101]Short Sleeves In Winter! A Lively Girl With A Big Smile! - A Fresh-Faced 19yo College Girl Makes Her Debut - Mio Watanabe

  • mio watanabe censoredbeautiful girlsingle workMIFDmoody susapyonmoodyz freshMIFD-101MIFD101mifd00101
    • 2020-02-22
    150 min

    [HND-788]An Idol From Sendai Catches The Night Bus To Tokyo For A Special Performance! - A Real Local Idol Makes Her Creampie Debut! - Neiro Otoha

  • otowa neiro censoredcreampiebeautiful girlHNDbookusapyonHND-788HND788hnd00788
    • 2020-02-22
    147 min

    [CAWD-060]Kawaii* x Creampie Sex 2 A Label Exclusive! A "Real" Idol From The Country Who Made Her Major Record Label Debut Is Taking Off Her Clothes For Us! Neiro Otoha Her Adult Video Debut

  • otowa neiro censoredbeautiful girlsingle workCAWDkawaiikc takedaCAWD-060CAWD060cawd00060
    • 2020-02-22
    154 min

    [HND-787]Newcomer - A Beautiful Local TV Announcer Who Graduated From A Big Name University Makes Her Porno Debut! - She's Sick Of Trying To Hide The Fact That She Loves Getting Fucked, So Now She's Here To Announce It To The World! - Tsukino

  • okawa tsukino censoredcreampiebeautiful girlHNDbookusapyonHND-787HND787hnd00787
    • 2020-02-22
    150 min

    [CAWD-063]She Looks Boyish And Cool, But She's Actually Shy And Inexperienced - Her Boyfriend Can't Make Her Cum, So She Decided To Make Her Porno Debut! - Yura Tsukinaga

  • tsukinaga yura censoredsquirtingbeautiful girlCAWDkawaiino directorCAWD-063CAWD063cawd00063
    • 2020-02-18
    249 min

    [SDAB-121]The Beat Of My Heart Doesn't Stop! - Yui Asakura - SOD Exclusive Porno Debut

  • asakura yui censoredschoolgirlbeautiful girlSDABsod createhajime yanaione s youthSDAB-121SDAB1211sdab00121



    • Jav Movie Free Download