big tits squirting def javcensored censored




FC2HODVSHKDSSISSQTECAWDDASDAVSAFSDSSGMEMVENUVEMALULUHMNSPRDPREDWANZONEZAWDGVHSAN

2024-05-06
83 min

NHDTB-92304 Sensitive Daughter 30 Black -haired Big Pie Librarian Who Can Not Speak In The Library And Overflows With Joy Juice.

  • censoredbig titssquirtingNHDTBnatural highitaka smithlin powdernatufileNHDTB-92304NHDTB923041nhdtb92304
    • 2024-05-06
    68 min

    NHDTB-92302 A Sensitive Daughter 30 Ponite Big J〇 J〇, Which Overflows As Joy Juice Overflows As You Can Not Speak In The Library

  • censoredbig titssquirtingNHDTBnatural highitaka smithlin powdernatufileNHDTB-92302NHDTB923021nhdtb92302
    • 2024-05-03
    174 min

    MIDV-637 Cum 168 Times Squirting 8000cc Convulsions 300 Times 100 Million Yen Body Eros Awakening Special Mitsuki Momota

  • momota mitsuki censoredbig titssquirtingMIDVmoody skyouseimoodyz divaMIDV-637MIDV637midv00637
    • 2024-05-03
    119 min

    CAWD-663 Another 20 -year -old Promise One -month Abstinence All Liberation H Cup Big Tits College Girl First Vaginal Cum Shot 3 Production!Akari Morimoto

  • morimoto akari censoredcreampiebig titsCAWDkawaiisugawaraCAWD-663CAWD663cawd00663
    • 2024-05-03
    120 min

    NPJS-019 Spell (The Ral) Email That Revived In The Former Saffle That Has Expired Tadaman"s Dignity!Sprinkle With The Frustrated Married Woman Who Received A Reply!!

  • censoredcreampiebig titsNPJSnpjNPJS-019NPJS019npjs00019
    • 2024-05-03
    120 min

    MIDV-706 The Body Of The K Cup That Repeats The Climax With Sweating And Repeated Climax ... SEX SEX Covered With Body Fluids That Are Dense Intertwined

  • saa niwa censoredbig titssquirtingMIDVmoody strendy yamaguchimoodyz divaMIDV-706MIDV706midv00706
    • 2024-04-26
    243 min

    MBM-833 Mpo.jp Presents The ☆ Non -fiction Amateur Nampa God Best Super Strict!Cool And Beautiful Skin Girl De M Acme Edition 12 People 4 Hours 2

  • censoredcreampiebig titsMBMmbmmpo selection.committeeMBM-833MBM833h-460mbm00833
    • 2024-04-22
    48 min

    NHDTB-91004 Sensitive (Shame) Big Tits Slut ● 2024 Estimated H Cup/Big Tits Women ○

  • censoredbig titssquirtingNHDTBnatural highneapolitannatufileNHDTB-91004NHDTB910041nhdtb91004
    • 2024-04-20
    320 min

    HOIZ-122 Hoi Hoi FRIENDS 09 Amateur Hoi Hoi FRIENDS, Personal Shooting, Saffle, Home, Home, Amateur, Beautiful Girls, Sister, Gonzo, Big Breasts, Big Breasts, Big Breasts, Busty, Squirting, Squirting, Cosplay, Cosplay, Documentary, Slut, Slut

  • censoredbig titsamateurHOIZamateur hoihoi delusion groupHOIZ-122HOIZ122hoiz00122
    • 2024-04-17
    95 min

    KSFN-015 Triple Meat Urinal Rings ● Circle -Meat Rusher No. 2 Saddle Records- * The Other Two Orgy Images Are Also Recorded

  • censoredbig titssquirtingKSFNsod createyamada veronicaKSFN-015KSFN0151ksfn00015
    • 2024-04-15
    170 min

    SGKI-017 Limited To The Yankee Couples In The Northern Kanto Region!A Prize Gift From A Woman -only Customs, A Male Therapist, A Huge Breasts And A Prize If She Doesn"t Speak At All!However, The Humiliation That The Voice Leaked NTR

  • censoredbig titssquirtingSGKIshigekidynanathat s no goodSGKI-017SGKI0171sgki00017
    • 2024-04-10
    84 min

    KSFN-014 Triple Meat Urinal Rings ● Circle -Meat Rusher No. 1 Saddle Records ~ * The Other Two Orgy Images Are Also Recorded

  • censoredbig titssquirtingKSFNsod createyamada veronicaKSFN-014KSFN0141ksfn00014
    • 2024-04-03
    103 min

    SQDE-002 Otori Kansai Dialect Perverted Sister.I"m Sorry For The Photographer!SEX That Panting With The Squirting For The First Time, Losing To The Comfort While Being Impatient!Haruka Mio River

  • miogawa haruka censoredcreampiebig titsSQDEs cuteSQDE-002SQDE002sqde00002
    • 2024-03-18
    65 min

    NHDTB-91001 Sensitive (Shame) Big Tits Slut ● 2024 Estimated G Cup/Beer Sales

  • censoredbig titssquirtingNHDTBnatural highneapolitannatufileNHDTB-91001NHDTB910011nhdtb91001
    • 2024-03-15
    120 min

    MIDV-663 "Until The Day We Meet Again ..." Crybaby Oma Kikuiku Development Pursuit Bachabacha 3 Production Ayumu Mori

  • honoka mori censoredbig titssquirtingMIDVmoody stake dmoodyz divaMIDV-663MIDV663midv00663
    • 2024-03-15
    120 min

    PPPE-185 "If You Don"t Get ...!" Interrogating The Busty Investigator Who Is Absolutely Incontinent In The Abandoned Habit Of The Busty Investigator Tachibana Mary.

  • tachibana mary censoredcreampiebig titsPPPEoppaiPPPE-185PPPE185pppe00185
    • 2024-03-15
    120 min

    PPPE-194 Spence Mammary Gland Development Clinic Kazuhana Misono

  • misono waka censoredcreampiebig titsPPPEoppaiPPPE-194PPPE194pppe00194
    • 2024-03-15
    160 min

    FPRE-027 Maso Awakening In The Second Exclusive FITCH!Beautiful Body Weather Sister"s Giova Joba Incontinence 3 Production Yukihira Misakura

  • yukihira mio censoredbig titssquirtingFPREfitchmichiru arashiyamapreciousFPRE-027FPRE027fpre00027
    • 2024-03-14
    127 min

    MTALL-105 [4K Shooting] GCUP Nipple Development Portio Beyond Portio Nipples Acme

  • itsukaichi mei censoredcreampiebig titsMTALLmateriallryo poleMTALL-105MTALL1051mtall00105
    • 2024-03-09
    54 min

    CRNX-103 [4K] Serious And Chaste Beauty Wives Can"t Forget The Past Man And Obscenity ...

  • itsukaichi mei censoredbig titssquirtingCRNXcrystal picturecrystal nextCRNX-103CRNX103crnx00103
    • 2024-02-16
    140 min

    MUKC-052 Estrus Cosplayer Immersed In Old Man Sensitive Mass Incontinence, Peeing, Squirting Off-paco 5SEX Miku Arima

  • arima misaki censoredcreampiebig titsMUKCinnocentsolid costMUKC-052MUKC052mukc00052
    • 2024-02-16
    180 min

    FPRE-018 Newcomer, Former Local Station Hcup Weather Girl Mio Yukihira AV Debut! The Beautiful Body Of A Young Lady Ejaculates In The First Shoot

  • yukihira mio censoredbig titssquirtingFPREfitchkyouseipreciousFPRE-018FPRE018fpre00018
    • 2024-02-16
    150 min

    EBWH-072 My Brother"s Wife"s Physical Beauty Is Too Attractive... Aphrodisiac Is Mixed With Protein And A Strong Woman"s Body Is Confirmed To Be Pregnant, Creampie Sex Maria Chihaya

  • chihaya maria censoredcreampiebig titsEBWHe bodytrendy yamaguchiEBWH-072EBWH072ebwh00072
    • 2024-02-16
    120 min

    EBWH-073 The No. 1 Body In The Athlete World, Drenched In Sweat, Juice, Tide, And Body Fluid Leaking Orgasm Hibiki Amemiya

  • amemiya hibiki censoredbig titssquirtingEBWHe bodyinabarEBWH-073EBWH073ebwh00073
    • 2024-02-16
    120 min

    PPPE-195 The Straight-laced Old Man Can"t Resist Seeing His Big-breasted Niece"s Free-spirited, Defenseless, Bra-less Nipples Flashing And Fluttery Side Breasts, Which He Took In For Discipline, So He Sucks Her Breasts And Rubs Them Violently

  • kasumi tsukino censoredcreampiebig titsPPPEoppaiPPPE-195PPPE195pppe00195
    • 2024-02-16
    120 min

    PPPE-204 Spence Breast Development Clinic Mary Tachibana

  • tachibana mary censoredcreampiebig titsPPPEoppaiPPPE-204PPPE204pppe00204
    • 2024-02-16
    160 min

    MIDV-629 Lifting Of The Ban: Creampie Sex For The First Time In My Life Sara Isshiki

  • isshiki sara censoredcreampiebig titsMIDVmoody smamezawa mametaromoodyz divaMIDV-629MIDV629midv00629
    • 2024-01-29
    113 min

    NHDTA-77101 China Matsuoka X Natural High This Is The Rumored Convulsive Drugged Swimsuit Model Screaming 10 Consecutive FUCK Excerpt Version

  • china matsuoka censoredbig titssquirtingNHDTAnatural highitaka smithlin powdernatufileNHDTA-77101NHDTA771011nhdta77101
    • 2024-01-25
    242 min

    ZOOO-107 Explosion Of Sexual Desire! A Thick Pussy That Gets Entangled With Nipples And Sucks! 50 Year Old Mature Woman Riding Cowgirl Position 4 Hours 8 People 2

  • even ayano mai fuyuki censoredcreampiebig titsZOOOzoooZOOO-107ZOOO107h-1515zooo00107
    • 2024-01-25
    126 min

    NHDTB-874 Immediate Squirt Gal Molester - Take Down The Impudent Gal With Continuous Squirting Until She Can No Longer Resist!

  • censoredbig titssquirtingNHDTBnatural highkansukechikanNHDTB-874NHDTB8741nhdtb00874
    • 2024-01-12
    120 min

    PPPE-172 Spence Breast Development Clinic Yuri Honma

  • really censoredcreampiebig titsPPPEoppaiPPPE-172PPPE172pppe00172
    • 2024-01-12
    150 min

    PPPE-187 A Dream Sex Industry Specializing In Titty Fucks. 6 Courses Of Absolute Squirting In Bust-emphasizing Costumes. Specializing In Breasts [extreme Paizuri Techniques And Extremely Close Angles] Yuria Yoshine

  • yoshine yuria censoredbig titsslutPPPEoppaiPPPE-187PPPE187pppe00187
    • 2023-12-31
    83 min

    HMDNV-682 [Tall, Plump And Perverted] Serious Housewife, 25-year-old Office Lady. Shy Masochistic Wife Goes Crazy And Has A Creampie Affair [F-cup Beautiful Big Breasts]

  • censoredbig titssquirtingHMDNVhmn workshamedori.network secondeditionHMDNV-682HMDNV682h-1472hmdnv00682
    • 2023-12-28
    244 min

    ZOOO-104 Estrus! Obscene Kisses And Intense Creampie Copulation Of 50-year-old Menopausal Mature Women - 20 People, 240 Minutes, Best 2

  • even ayano mai fuyuki censoredcreampiebig titsZOOOzoooZOOO-104ZOOO104h-1515zooo00104
    • 2023-12-22
    35 min

    AIDV-001 World"s First New AI Actress, Perfect Beautiful Face Ai Konohana AV Debut

  • kibana ai censoredbig titssquirtingAIDVh m pcrestfantasyAIDV-001AIDV0015642aidv00001
    • 2023-12-06
    46 min

    MMGH-296 Magic Mirror First DEEP "Breast Massage" The Frustration I Had Hidden Explodes At The Gentle And Warm Touch Of A Man That I Felt For The First Time In A While! ？ Convulsions With Penis Other Than Husband [Yui Edition]

  • censoredbig titssquirtingMMGHsod createsaijo akiramagic mirrorMMGH-296MMGH2961mmgh00296
    • 2023-12-04
    58 min

    BRV-002 A Naughty Date With That Big-breasted Girl - Tokyo/Fukuoka Edition - She"s A Beautiful Girl, But She Also Has The Strongest Breasts!

  • censoredbig titssquirtingBRVbravoBRV-002BRV002h-1755brv00002
    • 2023-11-24
    51 min

    FTHT-162 [Detox That Drips A Lot Of Juice With Intense Fingering] Please Don"t Play With Me! [At The End Of The Sentence, "please Insert It"] I Have A Habit Of Always Asking For Secret Options! [The Trap Of The Girl Beauty Salon! Restrain

  • censoredbig titssquirtingFTHTfaleno tubeFTHT-162FTHT1621ftht00162
    • 2023-11-13
    55 min

    NHDTB-86301 Slut Summer Festival 2023 Creampie Special Festival-like Slut Sensitive Yankee Gal

  • censoredcreampiebig titsNHDTBnatural highneapolitannatufileNHDTB-86301NHDTB863011nhdtb86301
    • 2023-11-09
    510 min

    NHDTB-790 Natural High Autumn Special Sensitive (Shameful) Big Tits Molester 2023 Complete Edition All 10 People SEX Breast Massage Shame Ver. 2 Disc Set 500 Minutes

  • censoredbig titssquirtingNHDTBnatural highkansukechikanNHDTB-790NHDTB7901nhdtb00790
    • 2023-10-13
    120 min

    PRED-525 Abstinence Acme Burst Goodbye, I"ll Go First To A World Drowning In Pleasure. With Her Tongue And Saliva Entwined, She Shakes Her Hips With All Her Might, Letting Sweat, Tide, And Juices Splatter Lewdly Until She Cums, Cums, Cums... Kare

  • karen kaede censoredcreampiebig titsPREDpremiumcomet akaielegancePRED-525PRED525pred00525
    • 2023-10-09
    56 min

    GML-135 Betrayal Affair 60th Anniversary Affair Wife Part 2 Shihori Mori

  • shihori mori censoredcreampiebig titsGMLglobal media entertainmentglobal media lightGML-135GML135gml00135
    • 2023-10-09
    69 min

    NHDTB-79009 Sensitive (shameful) Big Breasted Molester 2023 Estimated G Cup/wetting JD

  • censoredbig titssquirtingNHDTBnatural highkansukenatufileNHDTB-79009NHDTB790091nhdtb79009
    • 2023-10-09
    64 min

    GML-134 Betrayal Affair 60th Anniversary Affair Wife Part 1 Haruka Yamamoto

  • haruka yamamoto censoredcreampiebig titsGMLglobal media entertainmentglobal media lightGML-134GML134gml00134
    • 2023-10-06
    129 min

    BKYNB-034 Whispering From The Slut God And Confirming Rapid Fire Brain Bug Support ASMR Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsBKYNBbon kyun bonBKYNB-034BKYNB0341bkynb00034
    • 2023-08-21
    56 min

    NHDTB-79005 Sensitive (Shame) Busty Slut 2023 Estimated E Cup / Fair-Skinned Transfer Student

  • censoredbig titssquirtingNHDTBnatural highkansukenatufileNHDTB-79005NHDTB790051nhdtb79005
    • 2023-08-18
    480 min

    MBM-697 The Habit Of A Plenty Of Orgasms Is Amazing Fifty-Something Rugs Scraping Futon Scraping Convulsions Climax Mature Woman 60 People 8 Hours 4

  • censoredcreampiebig titsMBMmbmsasazuka garouMBM-697MBM697h-460mbm00697
    • 2023-08-03
    165 min

    FVMD-010 Bottom Female YouTuber ``Tempting My Younger Brother Surprise"" Planning Shooting Was Too Spearful And My Brother Was Seriously Lusted

  • ayaka mochizuki natsuki rio censoredcreampiebig titsFVMDfavemodefave modeFVMD-010FVMD010h-1668fvmd00010
    • 2023-07-24
    70 min

    NHDTB-81202 Little Girl Restraint Super Leverage Evil Este 6 Busty Girl

  • censoredbig titssquirtingNHDTBnatural highraftin maeshironatufileNHDTB-81202NHDTB812021nhdtb81202
    • 2023-07-24
    69 min

    NHDTB-79004 Sensitive (Shame) Busty Slut 2023 Estimated I Cup / De M Bank Employee

  • censoredbig titssquirtingNHDTBnatural highkansukenatufileNHDTB-79004NHDTB790041nhdtb79004
    • 2023-07-14
    131 min

    FTHT-120 [Public Relations Departments Of Major Companies Have Different Levels Of Looks And Sex! Sensitivity Is Incomparable! I Love Ji ○ Po And Take 3P! ] A Beautiful PR Staff Member Of An Instant Food Maker Dies Without Waiting For 3 Minutes! The

  • censoredcreampiebig titsFTHTfaleno tubedavielFTHT-120FTHT1201ftht00120
    • 2023-07-08
    106 min

    USBA-065 Hime-chan, A Voluptuous Gal Who Can Get Fucked Anytime, Is A Horny Saffle Who Loves Cock! Hime Shirayuki

  • shirayuki hime censoredbig titssquirtingUSBAavs collector sthin blade purpleavscollector sUSBA-065USBA065usba00065
    • 2023-07-06
    127 min

    DRPT-047 Forced Nipples Visible From Under A Sailor Uniform On A Crowded Train - A Girl With Colossal Tits Being Developed Shion Yumi

  • evening beauty censoredbig titssquirtingDRPTdennou rasputinlemon heart nakajimaDRPT-047DRPT0471drpt00047
    • 2023-07-06
    118 min

    FSDSS-626 An Old Man Who Hates Unfriendly Daddy"s Active Gal"s Persistent Sexual Development Makes Meat Onaho Ranran Fujii

  • fujii ranna censoredbig titssquirtingFSDSSfalenoyasha monkeyfaleno starFSDSS-626FSDSS6261fsdss00626
    • 2023-06-30
    120 min

    WAAA-279 Pies Many Times In The State Of "It"s Already Gone!" Riho Fujimori

  • riho fujimori censoredcreampiebig titsWAAAones factorywanzWAAA-279WAAA279waaa00279
    • 2023-06-16
    120 min

    EBOD-981 An Unaware J-Cup With Clothed Big Tits Is A Filthy Teacher Hoi Hoi She Was Trained With A Quick-Effecting Aphrodisiac And Squirting In The Train, And Even If The Train Ends At A Quiet Station, No One Can Help You... Mahi Sakura

  • sakuramanichi censoredcreampiebig titsEBODe bodytake dEBOD-981EBOD981ebod00981
    • 2023-06-16
    170 min

    PPPE-121 Spence Breast Development Clinic Special Sakuramahi

  • sakuramanichi censoredcreampiebig titsPPPEoppaiPPPE-121PPPE121pppe00121
    • 2023-06-16
    150 min

    JUFE-481 Squirting Climax Food Delivery SEX Of Transcendental K Cup Carnivorous Delivery Man Who Hunts Men In Erotic Appearance! Marina Yuzuki

  • marina yuzuki censoredcreampiebig titsJUFEfitchJUFE-481JUFE481jufe00481
    • 2023-06-16
    140 min

    EBOD-986 Serious (Gachi) Hard Piston Gcup Shaking Trance Climax Sexual Intercourse That Seems To Break A Small Body Kanau Arisu

  • arisu kanau censoredbig titssquirtingEBODe bodycrestEBOD-986EBOD986ebod00986
    • 2023-06-16
    118 min

    MIDV-392 Undeveloped I Cup Boobs Sensual Development First Milk Iki Nanami Hoshina

  • hoshichichi nanami censoredbig titssquirtingMIDVmoody sdragon nishikawamoodyz divaMIDV-392MIDV392midv00392



    • Jav Movie Free Download